Table 2.
SCAAP subjects [7]. IP: estimated isoelectric point. HM: hydrophobic moment. TI: calculated therapeutic index. Peptides Cecropin-A and CA(1-8)M(1-18)NH2 were used to determine the P[i, j] incidence matrix.
| Entry | Peptide | Sequence | IP | HM | TI |
|---|---|---|---|---|---|
| 1 | (KIAKKIA)2NH2 | KIAKKIAKIAKKIA | 11.5 | 0.48 | 86.2 |
| 2 | (KLGKKLG)3NH2 | KLGKKLGKLGKKLGKLGKKLG | 11.7 | 0.49 | 98.3 |
| 3 | Cecropin-A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | 11.2 | 0.44 | 1000.0 |
| 4 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | 12.6 | 0.46 | 500.0 |
| 5 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | 10.8 | 0.56 | 75.0 |
| 6 | CA(1-13)M(1-13)NH2 | KWKLFKKIEKVGQGIGAVLKVLTTGL | 11.1 | 0.53 | 400.0 |
| 7 | CA(1-8)M(1-18)NH2 | KWKLFKKIGIGAVLKVLTTGLPALIS | 10.4 | 0.43 | 2000.0 |