Table 4.
SCAAP subjects identified by the polarity index method in APD Gram+/Gram− bacteria database [11] where peptides have action only on bacteria. IP: estimated isoelectric point. HM: hydrophobic moment. Status: (X) not accepted for its IP and HM parameters, because the corresponding calculations were out of the ranges [7] (see Section 2.1).
| No. | Peptide | Sequence | IP | HM | Status | Reference |
|---|---|---|---|---|---|---|
| 1 | Clavanin D (sea squirt, tunicate, invertebrates, animals) | AFKLLGRIIHHVGNFVYGFSHVF | 10.85 | 0.54 | [21] | |
| 2 | Palustrin-1b (frog, amphibians, animals; XXU) | ALFSILRGLKKLGNMGQAFVNCKIYKKC | 10.80 | 0.49 | [22] | |
| 3 | Palustrin-1d (frog, amphibians, animals; XXU) | ALSILKGLEKLAKMGIALTNCKATKKC | 10.50 | 0.35 | [22] | |
| 4 | Palustrin-1c (frog, amphibians, animals; XXU) | ALSILRGLEKLAKMGIALTNCKATKKC | 10.60 | 0.35 | [22] | |
| 5 | Brevinin-1PRc (frog, amphibians, animals; XXU) | FFPMLAGVAARVVPKVICLITKKC | 10.50 | 0.38 | [23] | |
| 6 | Brevinin-1Be (frog, amphibians, animals; XXU) | FLPAIVGAAAKFLPKIFCVISKKC | 10.30 | 0.43 | [24] | |
| 7 | Brevinin-1HSa (frog, amphibians, animals; XXU) | FLPAVLRVAAKIVPTVFCAISKKC | 10.50 | 0.40 | [25] | |
| 8 | Brevinin-1Ba (frog, amphibians, animals; XXU) | FLPFIAGMAAKFLPKIFCAISKKC | 10.30 | 0.50 | [24] | |
| 9 | Brevinin-1Bc (frog, amphibians, animals; XXU) | FLPFIAGVAAKFLPKIFCAISKKC | 10.30 | 0.49 | [24] | |
| 10 | RANATUERIN 4 (ranatuerin-4, frog, amphibians, animals; XXU) | FLPFIARLAAKVFPSIICSVTKKC | 10.50 | 0.46 | [26] | |
| 11 | Phylloseptin-H11 (PLS-H11, Phylloseptin-13, PS-13; frog, amphibians, animals; XXA) | FLSL IPHAINAVGVHAKHF | 9.65 | 0.36 | [27] | |
| 12 | Phylloseptin-H5 (phylloseptin-7, PLS-H5, PS-7, XXA, frog, amphibians, animals) | FLSLIPHAINAVSAIAKHF | 9.65 | 0.45 | [28] | |
| 13 | Phylloseptin-H2 (PLS-H2, Phylloseptin-2, PS-2) (XXA, frog, amphibians, animals) | FLSLIPHAINAVSTLVHHF | 7.80 | 0.46 | X | [29] |
| 14 | Phylloseptin-B1 (PLS-B1, PBN1; frog, amphibians, animals; XXA) | FLSLIPHIVSGVAALAKHL | 9.65 | 0.46 | [30] | |
| 15 | Papilosin (tunicate, ascidian, invertebrates, sea animals) | GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ | 11.40 | 0.32 | [31] | |
| 16 | SMAP-34 (sheep myeloid antimicrobial peptide-34; OaMAP34, ovine cathelicidin, sheep, ruminant, animals) | GLFGRLRDSLQRGGQKILEKAERIWCKIKDIFR | 10.43 | 0.48 | [32] | |
| 17 | Caerin 1.17 (frog, amphibians, animals; XXA) | GLFSVLGSVAKHLLPHVAPIIAEKL | 9.50 | 0.49 | [33] | |
| 18 | Caerin 1.18 (frog, amphibians, animals; XXA) | GLFSVLGSVAKHLLPHVVPVIAEKL | 9.50 | 0.50 | [33] | |
| 19 | Fallaxidin 3.2 (XXA, frog, amphibians, animals) | GLLDFAKHVIGIASKL | 9.50 | 0.49 | [34] | |
| 20 | Fallaxidin 3.1 (XXA, frog, amphibians, animals) | GLLDLAKHVIGIASKL | 9.50 | 0.48 | [34] | |
| 21 | Dahlein 5.2 (frog, amphibians, animals) | GLLGSIGNAIGAFIANKLKPK | 11.10 | 0.52 | [35] | |
| 22 | Caerin 1.2 (XXA, frog, amphibians, animals) | GLLGVLGSVAKHVLPHVVPVIAEHL | 7.02 | 0.49 | X | [36] |
| 23 | Caerin 1.4 (XXA, frog, amphibians, animals) | GLLSSLSSVAKHVLPHVVPVIAEHL | 7.02 | 0.48 | X | [36] |
| 24 | Palustrin-2SIb (frog, amphibians, animals; XXU) | GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE | 10.10 | 0.36 | [37] | |
| 25 | XPF (the xenopsin precursor fragment, African clawed frog, amphibians, animals) | GWASKIGQTLGKIAKVGLKELIQPK | 11.00 | 0.40 | [38] | |
| 26 | Pleurocidin (fish, animals) | GWGSFFKKAAHVGKHVGKAALTHYL | 11.00 | 0.34 | [39] | |
| 27 | Cecropin (insects, invertebrates, animals) | GWLKKIGKKIERVGQNTRDATVKGLEVAQQAANVAATVR | 11.30 | 0.36 | [40] | |
| 28 | Pm_mastoparan PMM (insects, invertebrates, animals; XXA; derivatives) | INWKKIASIGKEVLKAL | 10.80 | 0.37 | [41] | |
| 29 | Hinnavin II (Hin II, insects, invertebrates, animals; JJsn) | KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG | 10.12 | 0.45 | [42] | |
| 30 | Ostrich AvBD2 (Ostrich avian beta defensin 2, ostricacin-1, OSP-1, birds, animals; BBL) | LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV | 8.94 | 0.33 | X | [43] |
| 31 | Clavanin D (sea squirt, tunicate, invertebrates, animals) | LFKLLGKIIHHVGNFVHGFSHVF | 10.80 | 0.56 | [44] | |
| 32 | Enterocin Q (EntQ, class 2d bacteriocins; leaderless, that is, no signal peptide, bacteria) | MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC | 10.00 | 0.39 | [45] | |
| 33 | Temporin-1Lb (Temporin 1Lb, frog, amphibians, animals) | NFLGTLINLAKKIM | 10.80 | 0.41 | [24] | |
| 34 | Bovine beta-defensin 6 (bBD-6,cow, ruminant, animals) | QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW | 11.30 | 0.37 | [46] | |
| 35 | mBD-4 (mBD4, mouse beta-defensin 4, or Defb4, animals; 3S=S) | QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR | 8.91 | 0.33 | X | [47] |
| 36 | ChBac5 (Pro-rich; Arg-rich, goat cathelicidin, ruminant, animals) | RFRPPIRRPPIRPPFNPPFRPPVRPPFRPPFRPPFRPPIGPFP | 13.45 | 0.50 | [48] | |
| 37 | Cyclic dodecapeptide (OaDode, ovine cathelicidin, sheep, ruminant, animals) | RICRIIFLRVCR | 12.00 | 0.36 | [49] | |
| 38 | Bactenecin (cyclic dodecapeptide, bovine cathelicidin, cow, cattle, ruminant, animals; BBMm; JJsn; derivatives: Bac2A) | RLCRIVVIRVCR | 12.00 | 0.33 | [50] | |
| 39 | RL-37 (RL37, cathelicidin, Old World monkey, primates, animals) | RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS | 11.90 | 0.59 | [51] | |
| 40 | BACTENECIN 7 (bac-7, bac 7; bac7; Pro-rich; cow cathelicidin, ruminant, animals; BBL, SeqAR, BBPP) | RRIRPRPPRLPRPRPRPLPFPRPGPRPIPRPLPFPRPGPRPIPRPLPFPRPGPRPIPRPL | 13.20 | 0.25 | [52] | |
| 41 | Bac4 (Pro-rich, Arg-rich; cow cathelicidin, ruminant, animals) | RRLHPQHQRFPRERPWPKPLSLPLPRPGPRPWPKPL | 12.90 | 0.23 | [53] | |
| 42 | Hyphancin IIIE (insects, invertebrates, animals) | RWKFFKKIERVGQNVRDGLIKAGPAIQVLGAAKAL | 11.80 | 0.41 | [54] | |
| 43 | Cecropin B (insects, invertebrates, animals) | RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAI | 11.40 | 0.42 | [55] | |
| 44 | Hyphancin IIID (insects, invertebrates, animals) | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKAL | 11.80 | 0.41 | [54] | |
| 45 | Hyphancin IIIG (insects, invertebrates, animals) | RWKVFKKIEKVGRHIRDGVIKAGPAITVVGQATAL | 11.80 | 0.38 | [54] | |
| 46 | Hyphancin IIIF (insects, invertebrates, animals) | RWKVFKKIEKVGRNIRDGVIKAGPAIAVVGQAKAL | 11.80 | 0.39 | [54] | |
| 47 | Phylloseptin-H4 (Phylloseptin-6, PLS-H4, PS-6, XXA, frog, amphibians, animals) | SLIPHAINAVSAIAKHF | 9.65 | 0.47 | [29] | |
| 48 | Pep5 (Lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria; XXT3; XXW3) | TAGPAIRASVKQCQKTLKATRLFTVSCKGKNGCK | 11.10 | 0.27 | [56] | |
| 49 | Clavanin C (sea squirt, tunicate, invertebrates, animals) | VFHLLGKIIHHVGNFVYGFSHVF | 9.55 | 0.47 | [21] | |
| 50 | Andropin (insects, invertebrates, animals) | VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK | 7.50 | 0.45 | X | [57] |
| 51 | Clavanin A (urochordates, sea squirts, and sea pork, tunicate, invertebrates, animals) | VFQFLGKIIHHVGNFVHGFSHVF | 9.71 | 0.61 | [21] |