Table 2.
Summary of proteomics data from the reduction and differential Cys labelling of 2B4 cells with TCEP. The Cys residues modified are indicated by residue number (@ followed by residue number in peptide) and whether the modification detected was MPB itself or a hydrolysis derivative (indicated by +H2O). Protein probability scores from iProphet meta-searches are shown and where applicable weighted spectral index counts (WSC) are shown for the reduced and control samples, respectively. The percentage sequence coverage indicates the percentage of the protein sequence where peptides were identified. Cys denotes the modified Cysteine number in the protein sequence inclusive of signal peptides.
| IPI accession | gene | protein description | protein identification probability | % sequence coverage | WSC control | WSC TCEP reduced | maleimide-modified peptide | modification | Cys |
|---|---|---|---|---|---|---|---|---|---|
| IPI00113869 | Bsg | CD147, Basigin | 1 | 20.5 | 1 | 4 | |||
| IPI00112752 | Cd27 | CD27 | 1 | 13.6 | TCEP only | NCTVTANAECSCSK | MPB+H2O@12 | 106 | |
| IPI00223769 | Cd44 | CD44 | 1 | 27.4 | TCEP only | SQEMVHLVNKEPSETPDQCMTADETR | MPB+H2O@19 | 347 | |
| IPI00124830 | Cd47 | CD47 | 1 | 9.6 | TCEP only | TAFNTDQGSACSYEEEK | MPB+H2O@11 | 142 | |
| IPI00123957 | Cd97 | CD97 | 1 | 15.7 | TCEP only | ||||
| IPI00420148 | Env | GP160 | 1 | 36.3 | TCEP only | WGCETTGQAYWKPSSSWDLISLK | MPB+H2O@3 | 131 | |
| CNPLVLEFTDAGK | MPB+H2O@1 | 181 | |||||||
| CNPLVLEFTDAGKK | MPB@1 | 181 | |||||||
| LTLSEVTGQGLCVGAVPK | MPB+H2O@12 | 356 | |||||||
| TFDFYVCPGHTVPTGCGGPR | MPB@16 | 109 | |||||||
| IPI00129526 | Hsp90b1 | endoplasmin | 1 | 17.6 | 1 | 13.96 | GVVDSDDLPLNVSR | ||
| IPI00133903 | Hspa9 | stress-70 protein | 1 | 61.1 | 4 | 47 | DQLPADECNK | MPB@8 | 608 |
| MEEFKDQLPADECNK | MPB@13 | 608 | |||||||
| AKCELSSSVQTDINLPYLTMDASGPK | MPB+H2O@3 | 317 | |||||||
| IPI00117424 | Icam2 | intercellular adhesion molecule 2 | 0.9981 | 5.8 | TCEP only | ||||
| IPI00119612 | Il2rg | CD132, cytokine receptor common gamma chain | 1 | TCEP only | CLQYLVQYR | MPB@1 | 163 | ||
| IPI00331413 | Itga6 | integrin alpha 6 | 1 | 34.1 | TCEP only | FGSCQQGVAATFTK | MPB+H2O@4 | 188 | |
| ACMEETLWLQENIR | MPB+H2O@2 | 562 | |||||||
| SMCGSPSGICLK | MPB@3 MPB+H2O@10 | 489 496 | |||||||
| YQTLNCSVNVR | MPB+H2O@6 | 928 | |||||||
| IPI00828582 | Itgal | integrin alpha-L | 1 | 37.6 | 1 | 59.63 | GSLLACDPGLSR | MPB+H2O@6 | 108 |
| RPSSEAEQPCLPGVQFR | MPB+H2O@10 | 1008 | |||||||
| VVVLSSRPVVDVVTELSFSPEEIPVHEVECSYSAR | MPB+H2O@30 | 633 | |||||||
| IPI00857195 | Itgav | integrin alpha-V | 1 | 52.5 | 1 | 78.3 | ICPLPGTALK | MPB+H2O@2 | 492 |
| GGQMQCEELVAYLR | MPB+H2O@6 | 565 | |||||||
| ARPVVTVNAGLEVYPSILNQDNKICPLPGTALK | MPB+H2O@25 | 565 | |||||||
| CLQITCQVGR | MPB+H2O@1 | 905 | |||||||
| IPI00132474 | Itgb1 | integrin beta-1 | 1 | 33.3 | TCEP only | FCECDNFNCDR | MPB@4 | 555 | |
| FQGPTCETCQTCLGVCAEHK | MPB@9 | 633 | |||||||
| IPI00320605 | Itgb2 | Integrin beta-2 | 1 | 50 | TCEP only | VMASECIQEQSFVIR | MPB@6 | 421 | |
| VMASECIQEQSFVIR | MPB+H2O@6 | 421 | |||||||
| ALGFTDTVTVQVRPQCECQCR | MPB+H2O@16 | 446 | |||||||
| YNSQVCGGSDR | MPB+H2O@6 | 550 | |||||||
| GHCQCNR | MPB+H2O@5 | 599 | |||||||
| EIFGQYCECDNVNCER | MPB+H2O@9 | 537 | |||||||
| IPI00877242 | Itgb3 | integrin beta-3 | 1 | 26.6 | TCEP only | ||||
| IPI00469218 | Lamp1 | lysosome-associated membrane glycoprotein 1 | 1 | 20.4 | TCEP only | ||||
| IPI00312063 | Ldlr | low-density lipoprotein receptor | 0.9995 | 3.8 | TCEP only | TTEDELHICR | MPB+H2O@9 | 843 | |
| IPI00119809 | Lgals3bp | galectin-3-binding protein | 1 | 29.6 | TCEP only | ||||
| IPI00223987 | Lnpep | leucyl–cystinyl aminopeptidase | 1 | 49.9 | TCEP only | SAFPCFDEPAFK | MPB@5 | 305 | |
| LPTAIIPLCYELSLHPNLTSMTFR | MPB+H2O@9 | 175 | |||||||
| EPCLHPLEPDEVEYEPR | MPB+H2O@3 | 35 | |||||||
| IPI00129646 | Ly9 | CD229, LY-9 | 1 | 21.4 | 1 | 13 | DAEIEHIIWNCPPK | MPB+H2O@11 | 82 |
| IPI00108844 | M6pr | CD222, cation-independent mannose-6-phosphate receptor | 1 | 21.6 | TCEP only | ||||
| IPI00125890 | Pdcd1 | CD279, PD-1 | 1 | 36.5 | TCEP only | QAAFCNGLSQPVQDAR | MPB+H2O@5 | 84 | |
| HEDGHCSWPL | MPB+H2O@6 | 264 | |||||||
| QAAFCNGLSQPVQDAR | MPB@5 | 84 | |||||||
| IPI00121788 | Prdx1 | peroxiredoxin-1 | 1 | 16.5 | TCEP only | ||||
| IPI00126092 | Ptprc | CD45 | 1 | 46.3 | 9.92 | 78.43 | CQLDNLR | MPB@1 | 337 |
| CPDYIIQK | MPB+H2O@1 | 776 | |||||||
| NVINVQTDLGIPETPKPSCGDPAAR | MPB+H2O@19 | 382 | |||||||
| CAEYWPSMEEGTR | MPB@1 | 749 | |||||||
| IPI00177179 | Pvr | CD155, poliovirus receptor | 1 | 15.4 | TCEP only | ENVQYSSVNGDCR | MPB@12 | 398 | |
| IPI00464135 | Sema4b | semaphorin-4B | 1 | 4 | TCEP only | LWVHNGAPVNASASCR | MPB+H2O@15 | 620 | |
| IPI00114274 | Sema4d | semaphorin-4D | 1 | 8.1 | TCEP only | ||||
| IPI00273801 | Slc39a10 | zinc transporter ZIP10 | 1 | 6 | TCEP only | CDPEKEAAELPIK | MPB@1 | 153 | |
| IPI00469000 | Slc39a6 | zinc transporter ZIP6 | 1 | 10.1 | TCEP only | AFCPDLDSDNSGK | MPB+H2O@3 | 153 | |
| IPI00114641 | Slc3a2 | CD98, 4F2 heavy chain | 1 | 49.8 | 5 | 28 | |||
| IPI00331577 | Slc7a5 | 4F2 light chain | 0.9993 | 9.8 | TCEP only | ||||
| IPI00124700 | Tfrc | CD71, transferrin receptor protein | 1 | 48 | 2 | 46 | VEQKEECVK | MPB@7 | 98 |
| IPI00109727 | Thy1 | CD90, Thy-1 | 1 | 25.3 | 1 | 7 | VTSLTACLVNQNLR | MPB+H2O@7 | 28 |