Table 1.
Proteins identified by LC-MS as altered in response to LPS±minocycline pre-treatment
| Protein spot number | Accession number | Uniprot recommended name (synonyms) | Fold change (control versus LPS) | Fold change (LPS versus minocycline + LPS) | Fold change (control versus minocycline) | p-Value | Peptides identified | % coverage |
|---|---|---|---|---|---|---|---|---|
| 1 | Unidentified | 2.72 | NS | NS | ||||
| 2 | Unidentified | 4.08 | NS | NS | ||||
| 3 | IPI00323357.3 | Heat shock protein 71 Cognate (Heat shock protein 70 protein 8) | 3.67 | 0.50 | 3.17 | 1.1×10−5 | TVTNAVVTVPAYFNDSQR | 8.03 |
| DAGTIAGLNVLR | ||||||||
| ARFEELNADLFR | ||||||||
| FEELNADLFR | ||||||||
| LLQDFFNGK | ||||||||
| 4 | IPI00223757.3 | Aldose reductase (Aldehyde reductase) | 2.33 | NS | 2.98 | 1.8×10−8 | TIGVSNFNPLQIER | 4.46 |
| 5 | IPI00468481.2 | ATP Synthase β-subunit, mitochondrial | NS | 5.10 | NS | 1.7×10−6 | FTQAGSEVSALLGR | 2.55 |
| 6 | IPI00468481.2 | ATP synthase β-subunit, mitochondrial | 3.15 | NS | NS | 1.5×10−8 | LVLEVAQHLGESTVR | 9.81 |
| LVDSGAPIKIPVGPETLGR | ||||||||
| AIAELGIYPAVDPLDSTSR | ||||||||
| 7 | Unidentified | 0.33 | 2.26 | NS | ||||
| 8 | IPI00227299.5 | Vimentin | 0.24 | 2.90 | NS | 7.3×10−13 | TYSLGSALRPSTSR | 34.24 |
| SLYSSSPGGAYVTR | ||||||||
| LLQDSVDFSLADAINTEFK | ||||||||
| FANYIDK | ||||||||
| ILLAELELQLK | ||||||||
| ILLAELELQLKGQGK | ||||||||
| EEAESTLQSFRQDVDNASLAR | ||||||||
| KVESLQEEIAFLK | ||||||||
| KVESLQEEIAFLKK | ||||||||
| FADLSEAANR | ||||||||
| FADLSEAANRNNDALR | ||||||||
| ISLPLPTFSSLNLR | ||||||||
| ETNLESLPLVDTHSK | ||||||||
| ETNLESLPLVDTHSKR | ||||||||
| DGQVINETSQHHDDLE | ||||||||
| 9 | IPI00338618.5 | Probable phospholipid transporting ATPase VA (ATPase class V type 10A; P-locus fat-associated ATPase) | 0.37 | NS | NS | 4.7×10−5 | FRGYIMHSNGEKAGLHK | 1.15 |
| 10 | IPI00462072.2 | α-Enolase (2-phospho-D-glycerate hydrolyase; Non-neural enolase) | 0.44 | NS | NS | 1.9×10−5 | YITPDQLADLYK | 3.06 |
| 11 | IPI00308885.5 | Heat shock protein 60 (60 kDa chaperonin; Chaperonin 60) | 0.27 | 3.98 | NS | 7.9×10−10 | LVQDVANNTNEEAGDGTTTATVLAR | 7.12 |
| VGLQVVAVK | ||||||||
| LSDGVALK | ||||||||
| 12 | IPI0046841.2 | ATP Synthase β-subunit, mitochondrial | 0.32 | NS | NS | 2.3×10−8 | LVLEVAQHLGESSTVR | 7.27 |
| FTQAGSEVSALLGR | ||||||||
| LVPLKETIK | ||||||||
| 13 | Unidentified | N/A | Not detected in LPS treatment | Not detected in control | ||||
| 14 | IPI00353314.5 | Olfactory Receptor Olfr 1204 | N/A | Not detected in LPS treatment | Not detected in control | 3.8×10−4 | PAATLPIDKAVALFYTMITPMLNPLIYTLR | 9.63 |
Summary of proteins identified by LC-MS analysis protein spots excised from two-dimension gels. Xcalibur 2.0 and Bioworks 3.1 software was used to identify proteins from LC-MS data. Fold change reported if statistically significantly altered (p<0.05), NS=not significant.