Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Sequence alignments of wild-type hBD1 and hBD3, the analogs 1C, 3I, and 3N, and the novel analog 3NI. The segments of sequences derived from hBD1 are shown in red, and those derived from hBD3 are shown in blue. The sequence of 3NI is KYYCRVRGGRCAVLSCPIFTKIQGTCSTRGRKCCRRKK, with a net charge of +12.
