Table 2.
Antimicrobial peptides used in this study
| Peptide | Class | Charge | Amino acid sequence | Secondary structure | Tissue source | Proposed mechanism of action | Reference |
|---|---|---|---|---|---|---|---|
| Protamine | Polyamine | +21 | PRRRRSSSRPIRRRRPRRASRRRRRRGGRRRR | Linear/extended | Reproductive tissues | Unknown for fungi | |
| Rational peptide 1 (RP-1) | Synthetic | +8 | ALYKKFKKKLLKSLKRLG | α-Helix | Modeled upon PF-4 α-helices | Perturbation of cell membrane and energetics | Current study |
| Human β-defensin 2 (hBD-2) | β-Defensin | +6 | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP | β-Hairpin/helix | Epidermis, mucosa | Perturbation of cell membrane, cell wall, and energetics | 14 |
| Human neutrophil protein 1 (HNP-1) | α-Defensin | +4 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | β-Hairpin | Neutrophil | Perturbation of cell membrane, ATP efflux and depletion | 31, 32 |
| LL-37 | Cathelicidin | +6 | [LL-37, 37 aa] | Extended/helix | Epidermis, mucosa, neutrophil | Unknown for fungi |