TABLE 6.

Peptides identified by LC/MS corresponding to superoxide dismutase from M. tuberculosis and M. smegmatis

Strain	Identified peptides	Protein	Accession number
M. tuberculosis wild type	AFWNVVNWADVQSREDHSAILLNEKYAATSQTKNLSPNGGDKPTGELAAAIADAFGSFDKAKEDHSAILLNEK	SodA superoxide dismutase (iron). M. tuberculosis H37Rv	NP_218363
M. tuberculosis ctpC::hyg	AFWNVVNWADVQSRYAATSQTKAKEDHSAILLNEKEDHSAILLNEK	SodA superoxide dismutase (iron). M. tuberculosis H37Rv	NP_218363
M. smegmatis wild type	AFWNVVNWDDVQNRNKSPNGGDKPTGELAAAIDDQFGSFDK	Msmeg_6427 superoxide dismutase (manganese)	ABK71950
M. smegmatis ctpC::hyg	AFWNVVNWDDVQNR	Msmeg_6427 superoxide dismutase [Mn]	ABK71950