TABLE 1.

SSO-modified CD36 peptides

Chymotryptic digests of CD36 from control and SSO-treated cells were analyzed using mass spectrometry and ProteinPilot software. Peptides with an oleate attached to a side chain of an amino acid residue of the CD36 backbone were found only in the SSO-treated samples. Two overlapping peptides, identified with high confidence, had the oleate attached to lysine 164. Two other peptides, mapping lysine 334 as the SSO target, were identified with lower confidence. Contribution scores range from 0 to 2, and confidence scores are shown in percent.

Contribution <0–2>	Confidence (%)	Peptide sequence	Peptide lysine	CD36 residue	Additional peptide modifications
1.96	99.00	QNQFVQMILNSLINKSKSSMF	Lys-15	Lys-164	Oxidation Met-7 and Met-20
1.82	99.00	NLAVAAASHIYQNQFVQMILNSLINKSKSSMF	Lys-26	Lys-164	Oxidation Met-18 and Met-31
0.89	95.31	DISKCKEGRPVY	Lys-6	Lys-334	Carbamidomethyl C5
0.00	59.59	KEGRPVY	Lys-1	Lys-334	None