TABLE 1.
SSO-modified CD36 peptides
Chymotryptic digests of CD36 from control and SSO-treated cells were analyzed using mass spectrometry and ProteinPilot software. Peptides with an oleate attached to a side chain of an amino acid residue of the CD36 backbone were found only in the SSO-treated samples. Two overlapping peptides, identified with high confidence, had the oleate attached to lysine 164. Two other peptides, mapping lysine 334 as the SSO target, were identified with lower confidence. Contribution scores range from 0 to 2, and confidence scores are shown in percent.
| Contribution <0–2> | Confidence (%) | Peptide sequence | Peptide lysine | CD36 residue | Additional peptide modifications |
|---|---|---|---|---|---|
| 1.96 | 99.00 | QNQFVQMILNSLINKSKSSMF | Lys-15 | Lys-164 | Oxidation Met-7 and Met-20 |
| 1.82 | 99.00 | NLAVAAASHIYQNQFVQMILNSLINKSKSSMF | Lys-26 | Lys-164 | Oxidation Met-18 and Met-31 |
| 0.89 | 95.31 | DISKCKEGRPVY | Lys-6 | Lys-334 | Carbamidomethyl C5 |
| 0.00 | 59.59 | KEGRPVY | Lys-1 | Lys-334 | None |