Table 1.
Peptide | Sequence | No. of aa | Net chargeb | Hydrophobic ratio (%)b | Origin | Reference(s) |
---|---|---|---|---|---|---|
Penetratin | RQIKIWFQNRRMKWKK-amide | 16 | +7 | 37 | Drosophila transcription factor Antennapedia | 61 |
pVEC | LLIILRRRIRKQAHAHSL-amide | 18 | +7 | 50 | Murine vascular endothelial cadherin | 9, 40 |
R41 | FILFILFILGGKHKHKHKHKHK-amide | 22 | +11 | 40 | Designed peptide | Unpublished |
R8 | GPPRFPPRFPPRFPPRFPPRFP-amide | 22 | +5 | 22 | Design based on sequence of PR-39 | Unpublished |
TP10 | AGYLLGKINLKALAALAKKIL-amide | 21 | +4 | 61 | Deletion analogue of transportan, a chimeric peptide | 26, 38, 39 |
M918 | MVTVLFRRLRIRRASGPPRVRV-amide | 22 | +7 | 45 | Tumor suppressor protein p14ARF | 62 |
YTA-4 | Acetyl-IAWVKAFIRKLRKGPLG-amide | 17 | +5 | 52 | Substrate of matrix metalloprotease 2 | 63 |
MAP | KLALKALKALKAALKLA-amide | 17 | +5 | 70 | Designed model amphipathic peptide | 9, 27 |
LL-37 | [LL-37, 37 aa] | 37 | +6 | 35 | Human cathelicidin | 64 |
Abbreviations: TP10, transportan-10; MAP, model amphipathic peptide; aa, amino acids.
As predicted by using the Antimicrobial Peptide Database website (http://aps.unmc.edu/AP/main.html) (65).