Skip to main content
. Author manuscript; available in PMC: 2014 Aug 1.
Published in final edited form as: Macromol Rapid Commun. 2013 Jul 9;34(15):10.1002/marc.201300460. doi: 10.1002/marc.201300460

Figure 1.

Figure 1

a) SDS-PAGE analysis of initiator attachment by SrtA. Lane 1: MW marker, lane 2: GFP–srt–ELP, lane 3: SrtA, lane 4: SCIA reaction mixture after 5 h of reaction, lane 5: purified GFP–C–Br macroinitiator. b) Isotopic distribution of GFP–C–Br C-terminal peptide [DHMVLLEFVTAAGITHGMDELYNVDGGGSLPET–“AEBMP”] 3+ detected by liquid chromatography tandem mass spectrometry (LC/MS-MS) after trypsin digestion.