Table 4.
Acetylated proteins detected in the cytosolic fractions
| Number of Modified Spectra |
||||||||
|---|---|---|---|---|---|---|---|---|
| Protein Name | Accession Number | Control | Acute acidosis | Chronic acidosis | Peptide Sequence | Modified Site* | Site-Determining Ion | Novel |
| Heat shock protein HSP 90-β | P34058 | 1 | TKPIWTRNPDDITQEEYGEFYK | K286 | No | Yes | ||
| Sorbitol dehydrogenase | P27867 | 1 | 1 | 1 | AAPAKGENLSLVVHGPGDIR | K6 | No | No |
| Transitional endoplasmic reticulum ATPase | P46462 | 3 | ASGADSKGDDLSTAILK | K8 | Yes | No | ||
| 40S ribosomal protein S24 | D4A6H5 | 1 | QMVIDVLHPGKATVPK | K32 | Yes | Yes | ||
| Similar to RIKEN cDNA C630028N24 gene (Predicted), isoform CRA_b | D3ZUX1 | 4 | SSGDDQQSQAFTKPTFTEAQASALVESIFGFK | K14 | No | No | ||
| Uncharacterized protein | F1LNM3 | 1 | 1 | DPSKELAGLFEHK | K2224 | No | Yes | |
| 14-3-3 Protein ζ/Δa | P63102 | 1 | NLLSVAYKNVVGAR | K49 | Yes | No | ||
| Aldo-keto reductase family 1, member C1 | Q3MHS3 | 1 | GVVVLAKSFTEKR | K275 | Yes | No | ||
| Acyl-CoA-binding protein | P11030 | 1 | ENAMKTYVEKVEELK | K72 or K77 | No | No | ||
| Cytoplasmic dynein 1 heavy chain 1 | P38650 | 1 | VQSKVNLK | K1113 | Yes | Yes | ||
| Uncharacterized protein | D4A5F2 | 5 | 4 | 5 | KNILLEEKLNK | K2445 | Yes | Yes |
| Uncharacterized protein | D3Z8J0 | 1 | KLKAQMD | K199 | No | Yes | ||
| Uncharacterized protein | F1LP82 | 1 | 1 | MITIDGKQIK | K53 | Yes | Yes | |
| 26S Protease regulatory subunit 4 | P62193 | 1 | TLLAKAVANQTSATFLR | K237 | No | Yes | ||
| RCG21481, isoform CRA_b | D3ZLD5 | 1 | 1 | DKFMLQAKVSELK | K1308 | Yes | Yes | |
*
If no site-determining ions were detected, all possible modification sites are listed. Trypsin does not cleave after an acetylated lysine. Thus a single internal lysine must be the site of modification for peptides with a single internal lysine, and no site-determining ion.