. 2014 Jan 16;10(1):e1003435. doi: 10.1371/journal.pcbi.1003435

Table 3. Conservation of the kinase-proximal CT domain sequences of HER/ErbB family receptors.

	^* `: . ::: :: :`^* `:` ^* `: :`
EGFR	`968-``PTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSR`
HER2	`977-PL``DSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPG`
HER3	`971-P``EPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGS`
HER4	`973-``PNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTS`

A multiple sequence alignment (Clustal Omega algorithm, http://www.ebi.ac.uk/Tools/msa/clustalo/) of the four human HER/ErbB family receptor sequences was performed, with sequence conservation in the kinase-proximal CT domain shown here. The high conservation of the HER/ErbB PTK domain sequences extended at least twenty-five residues into the CT domain, and thus included P-site-992 of the EGFR, with homologous P-sites seen in the cases of HER2 and HER4 but not in the case of the kinase-impaired HER3. EGFR Tyr-992 and its homologs in HER2 and HER4 and acidic residues are shown in bold lettering. Numbering of the first CT domain residue in each receptor is that of the mature receptor form, i.e. with the predicted signal peptide removed.

fully conserved residue.

:strongly similar residue.

.weakly similar residue.