TABLE 1.
Peptide fragment observed by mass spectrometrya | No. of phosphorylation events; location(s)b | [M+H]+ |
Type of MS analysis used |
|||
---|---|---|---|---|---|---|
Calculated | Observed | MALDI | ESI | MS/MS | ||
KAPpTPPPR | 1; T348 | 943.4761 | 943.4575 | Yes | No | Yes |
IPCQLPpSPE | 1; S146 | 1120.4743 | 1120.4482 | Yes | Yes | Yes |
GpSPPSEASSSVSQLSAPSLR | 1; S222 | 2023.9332 | 2023.9508 | Yes | Yes | Yes |
GpSPPpSEASSSVSQLSAPSLR | 2; SS222/225 | 2103.8995 | 2103.8706 | Yes | Yes | Yes |
GSPPSEASSSVSQLSAPSLR | 3; multiple isomers | 2183.8659 | 2183.8477 | Yes | No | Yes |
GSPPSEASSSVSQLSAPSLR | 4; multiple isomers | 2263.8322 | 2263.811 | Yes | No | Yes |
GSPPSEASSSVSQLSAPSLR | 5; multiple isomers | 2343.7985 | 2343.7756 | Yes | No | Yes |
GSPPSEASSSVSQLSAPSLR | 6; unassigned | 2423.7648 | 2423.7419 | Yes | No | No |
GSPPSEASSSVSQLSAPSLR | 7; unassigned | 2503.7311 | 2503.7082 | Yes | No | No |
ATCTTHSNTYDVDMVDANLLMEGGVAQTEPESR | 1; T242 or T244 or T245 or S247 or T249 | 3724.5449 | 3724.5441 | No | Yes | Yes |
TFGQPPSSGDAGSSTGAGAAE | 1; S387 or S388 | 1931.7655 | 1931.7629 | No | Yes | Yes |
SGGPTSPGEPAPSE | 1; S396 or T400 or S401 | 1349.5257 | 1349.5414 | Yes | No | Yes |
Bold and underlining in sequences indicate phosphorylated residues and putative phosphorylated residues respectively.
JFH-1 NS5A protein numbering.