Skip to main content
. 2014 Feb;88(3):1421–1432. doi: 10.1128/JVI.03017-13

TABLE 1.

NS5A phosphopeptides identified by mass spectrometry

Peptide fragment observed by mass spectrometrya No. of phosphorylation events; location(s)b [M+H]+
Type of MS analysis used
Calculated Observed MALDI ESI MS/MS
KAPpTPPPR 1; T348 943.4761 943.4575 Yes No Yes
IPCQLPpSPE 1; S146 1120.4743 1120.4482 Yes Yes Yes
GpSPPSEASSSVSQLSAPSLR 1; S222 2023.9332 2023.9508 Yes Yes Yes
GpSPPpSEASSSVSQLSAPSLR 2; SS222/225 2103.8995 2103.8706 Yes Yes Yes
GSPPSEASSSVSQLSAPSLR 3; multiple isomers 2183.8659 2183.8477 Yes No Yes
GSPPSEASSSVSQLSAPSLR 4; multiple isomers 2263.8322 2263.811 Yes No Yes
GSPPSEASSSVSQLSAPSLR 5; multiple isomers 2343.7985 2343.7756 Yes No Yes
GSPPSEASSSVSQLSAPSLR 6; unassigned 2423.7648 2423.7419 Yes No No
GSPPSEASSSVSQLSAPSLR 7; unassigned 2503.7311 2503.7082 Yes No No
ATCTTHSNTYDVDMVDANLLMEGGVAQTEPESR 1; T242 or T244 or T245 or S247 or T249 3724.5449 3724.5441 No Yes Yes
TFGQPPSSGDAGSSTGAGAAE 1; S387 or S388 1931.7655 1931.7629 No Yes Yes
SGGPTSPGEPAPSE 1; S396 or T400 or S401 1349.5257 1349.5414 Yes No Yes
a

Bold and underlining in sequences indicate phosphorylated residues and putative phosphorylated residues respectively.

b

JFH-1 NS5A protein numbering.