Skip to main content
. 2014 Feb 4;14:7. doi: 10.1186/1472-6890-14-7

Figure 4.

Figure 4

MS/MS fragmentation and sequence data for identified peptides. A. The m/z 5805.0 peak (SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEG-THSTKRGHAKSRP) was identified as a fragment of isoform 1 of fibrinogen alpha chain (IPI00021885) with an ion score of 122 from m/z [726.214]8+. The spectrum shown is the sum of 28 scans in range 130 (rt = 22.952) to 198 (rt = 31.9511). B. The m/z 1350.8 peak (SGEGDFLAEGGGVR) was also identified as a fragment of fibrinogen alpha chain with an ion score of 95 from m/z [675.82]2+.