Table 1.
MaxiK α subunit domains and protein complexes
| Interacting proteins | MaxiKα interaction/association motif | Method | Co-IP or co-labeling | Ref |
|---|---|---|---|---|
| Transmembrane proteins | ||||
| Direct Interactions | ||||
| β2-subunit | S1 transmembrane domain (aa 112GRVL--YFID133, #U11058) | prokaryote two-hybrid system | in vitro | [50] |
| Thromboxane A2 receptor | voltage-sensing-conduction cassette including N-terminus (aa 1MDAL---YVPE321, #U11058) | FRET | coronary smooth muscle | [35] |
| Intracellular proteins | ||||
| Direct interactions | ||||
| FAK | Whole C-terminus (388IELI---EERL1178, #U13913) | yeast two-hybrid system | osteosarcoma cells (MG63) | [58] |
| Microtubule-associated protein1A | partial C-terminus (aa 746–1144*) | yeast two-hybrid system | brain, Purkinje cells | [55] |
| β-catenin | “S10” hydrophobic segment (941PFAC---TYF962, numbers as in [61]) | yeast two-hybrid system | chicken hair cells | [33] |
| Cereblon | Partial C-terminus (encompassing RCK1 and part of RCK2 domains upstream the Ca2+-bowl; aa 394–955 of rSlo*) | yeast two-hybrid system | brain, hippocampal neurons | [23] |
| ANKRA | C-terminal end (downstream the Ca2+ bowl, aa 1019SLM--MVYR1210, #AF135265.1) | yeast two-hybrid system | brain | [37] |
| Actin | FGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPT | purified proteins | chick ciliary ganglion | [103] |
| cPLA2 | AKPGKLPLVSVNQEKNSGTHILMITEL (in 27 aa splice insert or ALCOREX) | mammalian two-hybrid system | GH3 cells | [34] |
| Rab11b | region excluding N- and C-terminus | yeast two-hybrid system | chick cochlea | [72] |
| Cortactin, CRKL | 656P and 667P in RxxPxxxP proline rich motifs | overlay assay | brain | [74] |
| MAGI-1 | C-terminus DEC variant (1111–1171*); sequence in Fig. 2 is as in [43] | yeast two-hybrid system | podocyte cell line | [60] |
| Cavβ1 | C-terminus fragments including Ca2+ bowl (884T–N936) or non-canonical SH3 binding domain (E637–D677)* | yeast two-hybrid system and purified proteins | chick ciliary ganglion neurons | [104] |
| Direct/Indirect? | ||||
| Nephrin | VEDEC variant* | GST pull-down assays | podocyte cell line | [25] |
| Syntaxin 1A | S0–S1 loop/C-terminus (336YSAVSG----VEDEC1166; numbers as in Fig. 2) | co-IP | brain | [12] |
| Caveolin-1 | Caveolin binding motif, YNMLCFGIY | co-IP | aorta | [2] |
| Tubulin | RCK2 to C-terminal end (679MDS---QEERL1113, #U11058) | pull-down with purified protein | astrocytes | [54] |
| PKA complex (PKA indirect) | leucine zipper 1, LAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIE | co-IP | brain | [75] |
| SyK | ITAM, YGDLFCKALKTYNML | co-IP | osteosarcoma cells(MG63) | [59] |
aa, amino acid; ANKRA, Ankyrin-repeat family A protein; co-IP, co-immunoprecipitation; cPLA2, cytosolic phospholipase A2; CRKL, Crk-like protein; FAK, focal adhesion kinase; ITAM, immunoreceptor tyrosine-based activation motif; MAGI-1, membrane-associated guanylate kinase with inverted orientation protein-1; PKA, protein kinase A; SH3, Src homology 3; ?, in these cases a direct or indirect interaction has not been demonstrated; #, NCBI accession number; *, NCBI accession number not given (amino acid numbers are as given in publications and may not coincide with template used in Fig. 2)