Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
The tryptic digest of the AM6701-inhibited hMGL was peptide fingerprinted using MALDI-TOF MS. (A) The enzyme was subjected to mild reduction-alkylation before trypsin digestion. (B) The enzyme was digested with trypsin without reduction-alkylation. High-resolution MS spectra of the precursor ions are shown for the unmodified (m/z 5247.62) and carbamylated (m/z 5318.76) peptide DYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAK (position 117–172).
