Table 2.
List of peptides found by nanoUHPLC–ESI-MS/MS protein identification experiments of jrPPO1(Asp101 → Arg445). Sequence coverage: 96%.
| Start–End | Sequence | Modifications | XCorr | Delta Mass [ppm] | Enzyme for digestion | Peptide mass |
|---|---|---|---|---|---|---|
| 101–110 | DPVSAPELTL | 2.12 | −0.71 | Chymotrypsin | 1040.5378 | |
| 101–131 | DPVSAPELTLcSEADLPAGALPVNccPPTSK | C11(Carbamidomethyl); C25(Carbamidomethyl); C26(Carbamidomethyl) | 6.56 | −2.17 | Trypsin | 3265.5230 |
| 111–136 | cSEADLPAGALPVNccPPTSKKIKDF | C1(Carbamidomethyl); C15(Carbamidomethyl); C16(Carbamidomethyl) | 5.93 | 2.45 | Chymotrypsin | 2874.3781 |
| 122–136 | PVNccPPTSKKIKDF | C4(Carbamidomethyl); C5(Carbamidomethyl) | 2.56 | 0.8 | Chymotrypsin | 1789.8865 |
| 132–146 | KIKDFVLPSQNTPLR | 3.15 | −1.79 | Trypsin | 1755.0007 | |
| 133–146 | IKDFVLPSQNTPLR | 5.19 | −2.01 | Trypsin | 1626.9056 | |
| 135–146 | DFVLPSQNTPLR | 3.16 | −0.74 | Trypsin | 1385.7288 | |
| 146–153 | RVRPAAHL | 1.8 | −0.32 | Chymotrypsin | 918.5504 | |
| 146–158 | RVRPAAHLVDNDY | 3.16 | 0.21 | Chymotrypsin | 1524.7795 | |
| 146–162 | RVRPAAHLVDNDYIAKY | 4.25 | 1.41 | Chymotrypsin | 2000.0615 | |
| 147–161 | VRPAAHLVDNDYIAK | 5.28 | −1.87 | Trypsin | 1680.8911 | |
| 154–162 | VDNDYIAKY | 2.58 | 0.48 | Chymotrypsin | 1099.5186 | |
| 163–180 | NKGIELmKSLPADDPRSF | M7(Oxidation) | 4.69 | −2.97 | Chymotrypsin | 2033.0187 |
| 169–180 | mKSLPADDPRSF | M1(Oxidation) | 3.27 | −1.82 | Chymotrypsin | 1378.6521 |
| 169–180 | MKSLPADDPRSF | 2.88 | −0.9 | Chymotrypsin | 1362.6585 | |
| 171–178 | SLPADDPR | 1.84 | −3.57 | Trypsin | 869.4207 | |
| 181–190 | TQQANVHcAY | C8(Carbamidomethyl) | 1.95 | −0.09 | Chymotrypsin | 1190.5132 |
| 181–195 | TQQANVHcAYcDGAY | C8(Carbamidomethyl); C11(Carbamidomethyl) | 2.55 | −1.21 | Chymotrypsin | 1756.6907 |
| 196–205 | TQVGFPDLSL | 2.23 | −0.68 | Chymotrypsin | 1075.5537 | |
| 219–226 | YYVYFFEK | 2.67 | −3.41 | Trypsin | 1157.5389 | |
| 224–231 | FEKILGKL | 2.9 | 0.55 | Chymotrypsin | 946.5852 | |
| 225–237 | EKILGKLIGDPTF | 1.9 | 0.48 | Chymotrypsin | 1429.8183 | |
| 229–237 | GKLIGDPTF | 2.38 | 1.92 | Chymotrypsin | 946.5137 | |
| 231–268 | LIGDPTFALPFWNWDSPPGmQLPSLYAVSNSAIYDPLR | M20(Oxidation) | 7.3 | −2.7 | Trypsin | 4264.0861 |
| 231–268 | LIGDPTFALPFWNWDSPPGMQLPSLYAVSNSAIYDPLR | 4.64 | 0 | Trypsin | 4248.1027 | |
| 245–256 | DSPPGmQLPSLY | M6(Oxidation) | 2.67 | −1.87 | Chymotrypsin | 1319.6038 |
| 245–256 | DSPPGMQLPSLY | 2.09 | 0.48 | Chymotrypsin | 1303.6120 | |
| 257–267 | AVSNSAIYDPL | 1.87 | 0.2 | Chymotrypsin | 1148.5711 | |
| 257–280 | AVSNSAIYDPLRNANHQPPTIIDL | 2.56 | −2.31 | Chymotrypsin | 2618.3388 | |
| 265–280 | DPLRNANHQPPTIIDL | 2.99 | −0.64 | Chymotrypsin | 1812.9466 | |
| 268–280 | RNANHQPPTIIDL | 2.38 | −1.54 | Chymotrypsin | 1487.7817 | |
| 268–299 | RNANHQPPTIIDLDYGETSESTTTTDQVPSNL | 6.4 | −1.69 | Chymotrypsin | 3513.6432 | |
| 269–300 | NANHQPPTIIDLDYGETSESTTTTDQVPSNLK | 7.62 | −0.5 | Trypsin | 3485.6412 | |
| 281–299 | DYGETSESTTTTDQVPSNL | 2.5 | 0.95 | Chymotrypsin | 2043.8771 | |
| 301–311 | ImYRQmVSGAK | M2(Oxidation); M6(Oxidation) | 2.23 | 0.26 | Trypsin | 1314.6423 |
| 304–316 | RQmVSGAKNPTLF | M3(Oxidation) | 4.59 | 2.34 | Chymotrypsin | 1463.7584 |
| 304–316 | RQMVSGAKNPTLF | 4.25 | −3.56 | Chymotrypsin | 1447.7549 | |
| 304–317 | RQmVSGAKNPTLFF | M3(Oxidation) | 3.91 | 0.35 | Chymotrypsin | 1610.8240 |
| 304–317 | RQMVSGAKNPTLFF | 2.97 | 0.3 | Chymotrypsin | 1594.8290 | |
| 312–322 | NPTLFFGSPYR | 3.87 | −1.66 | Trypsin | 1297.6429 | |
| 322–344 | RAGDEPDPGAGTIESTPHNNIHL | 7.11 | −0.59 | Chymotrypsin | 2397.1290 | |
| 322–345 | RAGDEPDPGAGTIESTPHNNIHLW | 8.28 | −3.12 | Chymotrypsin | 2583.2017 | |
| 346–360 | TGDDTQPNIENmGNF | M12(Oxidation) | 3.01 | −1.67 | Chymotrypsin | 1667.6701 |
| 346–360 | TGDDTQPNIENMGNF | 2.75 | −2.03 | Chymotrypsin | 1651.6746 | |
| 346–361 | TGDDTQPNIENmGNFY | M12(Oxidation) | 3.17 | −1.57 | Chymotrypsin | 1830.7333 |
| 346–361 | TGDDTQPNIENMGNFY | 3.05 | −0.21 | Chymotrypsin | 1814.7409 | |
| 361–370 | YSAGRDPIFF | 2.72 | 0.52 | Chymotrypsin | 1171.5663 | |
| 362–370 | SAGRDPIFF | 2.18 | −1.06 | Chymotrypsin | 1008.5013 | |
| 362–380 | SAGRDPIFFAHHSNVDRmW | M18(Oxidation) | 4.16 | −0.72 | Chymotrypsin | 2258.0419 |
| 366–378 | DPIFFAHHSNVDR | 4.06 | −2.08 | Trypsin | 1553.7338 | |
| 371–380 | AHHSNVDRmW | M9(Oxidation) | 3.04 | −0.51 | Chymotrypsin | 1267.5505 |
| 371–383 | AHHSNVDRmWTIW | M9(Oxidation) | 2.42 | 0.27 | Chymotrypsin | 1667.7627 |
| 379–384 | mWTIWK | M1(Oxidation) | 1.92 | −2.6 | Trypsin | 879.4285 |
| 379–384 | MWTIWK | 1.78 | −1.26 | Trypsin | 863.4348 | |
| 384–399 | KTLGGKRKDITDPDWL | 3.14 | −0.9 | Chymotrypsin | 1841.9978 | |
| 387–399 | GGKRKDITDPDWL | 3.04 | −0.61 | Chymotrypsin | 1499.7719 | |
| 387–403 | GGKRKDITDPDWLNSSF | 3.94 | 0.36 | Chymotrypsin | 1934.9489 | |
| 391–414 | KDITDPDWLNSSFFFYDENADPVR | 7.56 | −1.24 | Trypsin | 2890.3046 | |
| 392–414 | DITDPDWLNSSFFFYDENADPVR | 7.01 | −1.48 | Trypsin | 2762.2091 | |
| 405–426 | FYDENADPVRVKVKDcVDNTKL | C16(Carbamidomethyl) | 6.25 | −0.33 | Chymotrypsin | 2624.2891 |
| 406–426 | YDENADPVRVKVKDcVDNTKL | C15(Carbamidomethyl) | 7.3 | −0.6 | Chymotrypsin | 2477.2201 |
| 406–428 | YDENADPVRVKVKDcVDNTKLRY | C15(Carbamidomethyl) | 5.94 | −0.41 | Chymotrypsin | 2796.3849 |
| 407–426 | DENADPVRVKVKDcVDNTKL | C14(Carbamidomethyl) | 6.03 | −0.71 | Chymotrypsin | 2314.1566 |
| 407–428 | DENADPVRVKVKDcVDNTKLRY | C14(Carbamidomethyl) | 6.48 | 2.13 | Chymotrypsin | 2633.3283 |
| 417–427 | VKDcVDNTKLR | C4(Carbamidomethyl) | 2.81 | −0.1 | Trypsin | 1346.6970 |
| 427–437 | RYVYQDVEIPW | 2.69 | −1 | Chymotrypsin | 1466.7174 | |
| 428–439 | YVYQDVEIPWLK | 4 | −2 | Trypsin | 1551.7937 | |
| 429–437 | VYQDVEIPW | 1.98 | −0.63 | Chymotrypsin | 1147.5537 | |
| 431–437 | QDVEIPW | 1.71 | −0.37 | Chymotrypsin | 885.4224 | |
| 431–445 | QDVEIPWLKTKPTPR | 3.9 | −0.39 | Chymotrypsin | 1806.9981 | |
| 438–445 | LKTKPTPR | 1.88 | 0.23 | Chymotrypsin | 939.5863 |