. Author manuscript; available in PMC: 2015 May 1.

Published in final edited form as: Plant J. 2014 Apr 15;78(3):491–515. doi: 10.1111/tpj.12490

Table 2.

Redox sensitive proteins identified in B. napus guard cells under MeJA treatment.^b

Name	Accession (gi)	Mr (kDa)/pI	Unused Score (ICAT)	Peptide (ICAT)	Fold Change (ICAT)	Mascot Score (DIGE)	Spot No./Fold Change	iTRAQ ratio
Photosynthesis (11)
Chlorophyll a/b binding protein	109389998	23/6.1				65	2315/0.57	4.56^NS
		25/4.7				60	2199/1.79
High chlorophyll fluorescence 136	15237225	44/6.8				118	1520/1.57	1.04^NS
Light harvesting chlorophyll A/B binding protein	4585935	27/5.3				75	2200/1.51	2.85^NS
Rubisco activase (RCA)	18405145	52/5.4				342	1378/0.53	1.21^NS
		52/5.0				250	1193/1.81
		51/5.0				227	1259/0.50
		35/5.3				157	1557/1.71
33 kDa subunit of the oxygen evolving complex	5748502	35/5.9				158	2073/1.99	1.01^NS
^&Ribulose-1,5-bisphosphate carboxylase/oxygenase	8745521	53/4.8	10.86	GHYLNATAGTCEEMMK	0.74	521	916/1.55	0.46^S
		53/4.5				335	905/3.03
^&Ribulose bisphosphate carboxylase small chain, chloroplast precursor (RuBisCO small subunit)	17852	20/8.2	8.09	LPLFGCTDSAQVLK	1.32			2.03^S
Ferredoxin-NADP(+)-oxidoreductase 2	15223753	41/8.5				66	1721/1.70	1.02^NS
^&Sedoheptulose-1,7-bisphosphatase	1173347	37/4.8				310	1569/1.59	1.13^NS
		37/4.9				128	1520/1.57
Thylakoid lumenal 15 kDa protein	18406661	24/7.6				134	2716/0.35	NO ID
Oxygen-evolving complex of photosystem II	21133	28/6.8				135	2287/0.56	NO ID
Energy (20)
Glyceraldehyde 3-phosphate dehydrogenase A subunit	166702	35/7.0				99	1619/1.70	0.93^NS
^&De-etiolated 3, V-ATPase subunit C	18391442	43/5.4				195	1354/4.04	1.92^S
^&Glyceraldehyde-3-phosphate dehydrogenase, cytosolic	120675	37/4.6				360	1573/1.66	1.17^NS
		37/4.6				354	1574/1.72
^&Chloroplast malate dehydrogenase	207667274	42/8.5				186	1660/1.69	1.02^NS
^&Fructose bisphosphate aldolase	14334740	43/6.5				77	1354/4.04	1.17^NS
ATP synthase beta subunit	8745523	54/5.2				694	905/3.03	1.56^S
Nucleotide-binding vacuolar ATPase	166627	65/5.0				725	842/0.60	1.16^NS
		65/4.3				472	897/1.56
Mitochondrial F1 ATP synthase beta subunit	17939849	63/4.5				694	905/3.03	1.97^S
^&ATP synthase subunit alpha, mitochondrial	114403	55/5.2				621	799/1.57
		55/6.3				252	753/0.61
		55/5.4				248	712/0.55	1.19^NS
		55/5.8				244	708/0.64
		37/5.0				178	1520/1.57
^&Glyceraldehyde 3-phosphate dehydrogenase B subunit	336390	43/5.6				201	1189/0.48	1.00^NS
^&Phosphoglycerate kinase 1 (PGK1)	15230595	43/4.7				282	1324/1.51	0.94^NS
		25/4.7				184	2247/1.88
		25/4.7				178	2231/1.53
		20/4.6				163	2405/3.28
		25/4.8				161	2287/0.56
^&Malate dehydrogenase, cytosolic	15219721	36/5.7				338	1509/1.95	1.16^NS
		36/4.6				188	1573/1.66
		36/4.9				142	1619/1.70
^&Fructose-bisphosphate aldolase	15231715	44/6.0				551	1189/0.48	1.55^NS
		43/4.7				233	1324/1.51
		44/5.0				164	1259/0.50
Enolase	34597330	48/5.5				683	988/2.41	1.02^NS
Isocitrate dehydrogenase	15218869	46/4.5				130	1140/0.47	1.10^NS
		46/4.5				101	1102/0.55
Pyruvate dehydrogenase E1 beta subunit	520478	39/5.2				223	1378/0.53	1.05^NS
		39/5.7				114	1482/1.52
Succinyl-CoA ligase (GDP-forming) beta-chain, mitochondrial	15225353	46/5.5				314	1297/0.66	1.46^S
		45/6.5				160	1354/4.04
^&Malate dehydrogenase, mitochondrial	899226	36/8.8	8.04	GLNGVPDVVECSYVQSTITELPFFASK	1.24	114	1737/0.54	1.11^NS
				AGKGSATLSMAYAGALFADACLK	1.44
				YCPHALVNMISNPVNSTVPIAAEIFKK	1.22
NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial	3122572	81/5.9				135	333/0.62	NO ID
^&Tonoplast ATPase 70 kDa subunit	558479	69/5.2				545	555/1.54	NO ID
Metabolism (36)
Glutamine synthetase	1526562	39/5.9				99	1509/1.95	1.23^NS
Streptomyces cyclase/dehydrase	89257688	21/4.0	2.00	SELAQSIAEFHTYHLGPGSCSSLHAQR	0.78	90	2529/0.43	1.14^NS
Homocysteine S-methyltransferase	15238686	84/6.1	4.11	CVKPPVIYGDVSRPK	1.20			1.09^NS
Cytosol aminopeptidase family protein	15235763	62/6.6				212	712/0.55	1.10^NS
S-adenosyl-L-homocysteine hydrolase	1710838	54/5.7				252	842/1.66	1.08^NS
Isoflavone reductase	15223574	35/5.4				112	1791/1.74	1.36^NS
Fumarate hydratase (FUM1)	15226618	47/8.0				102	1102/0.55	1.13^NS
Oligopeptidase A-like protein	7671449	82/5.4				63	370/0.59	1.56^NS
^&3-ketoacyl-acyl carrier protein synthase I	780814	51/6.5				379	1001/0.65	1.00^NS
		51/6.4				298	981/0.54
Delta1-pyrroline-5-carboxylate synthetase	938021	78/6.0				108	386/0.43	0.81^NS
Nucleotide-rhamnose synthase/epimerase-reductase (NRS/ER)	18407710	34/5.7				140	1737/0.54	1.06^NS
^&Adenosine kinase 1 (ADK1)	15232763	45/5.3				149	1354/4.04	1.03^NS
		39/5.2				143	1378/0.53
		48/5.2				75	1158/1.91
Thi1 protein	1113783	37/5.8				206	1791/1.74	1.02^NS
Leucine aminopeptidase	16394	55/5.7				62	828/1.65	1.12^NS
Triosephosphate isomerase	4803926	33/7.7				200	2073/1.99	1.60^NS
^&Oxalic acid oxidase	60686421	21/9.1	4.77	AETPAGYPCIRPIHVK	1.24			18.54^S
3-isopropylmalate dehydrogenase	9757801	44/5.7				88	1908/1.81	1.80^NS
Dihydrolipoamide dehydrogenase 1, mitochondrial/lipoamide dehydrogenase 1	15221044	54/7.0				141	753/0.61	0.93^NS
^&Reversibly glycosylated polypeptide-2	9755610	41/5.8				78	1378/0.53	1.14^NS
Glutamate-1-semialdehyde-2,1-aminomutase	15242822	51/6.4				211	1189/0.48	1.01^NS
Dihydrolipoamide S-acetyltransferase	5881963	50/8.3				64	1001/0.65	1.45^NS
Transketolase-like protein	7329685	82/5.8				280	374/0.65	0.93^NS
		82/5.9				274	393/0.60
Aldehyde dehydrogenase	15220881	55/6.1	2.01	LGPALACGNTVVLK	1.53			2.36^S
ADP-glucose pyrophosphorylase small subunit	7688095	57/6.9	3.22	SCISEGAIIEDTLLMGADYYETDADR	1.66	182	1006/1.70	1.30^NS
Serine hydroxymethytransferase 1 (SHM1)	15235745	58/8.1				198	905/3.03	1.21^NS
3-chloroallyl aldehyde dehydrogenase/aldehyde dehydrogenase (NAD)	18404212	55/5.5				60	754/0.61	NO ID
Unnamed protein, containing chalcone-flavanone isomerase domain	219914490	23/4.9				125	2287/0.56	NO ID
Aldo-keto reductase, putative	223530647	37/5.5				118	1660/1.69	NO ID
9-cis-epoxycarotenoid dioxygenase 4	84579412	65/7.6				53	92/0.55	NO ID
3-isopropylmalate dehydratase-like protein (small subunit)	15231608	27/6.4	1.53	EHAPVCLGAAGAK	1.39			NO ID
Cytokinin-O-glucosyltransferase 1	195632542	54/5.6				47	345/0.60	NO ID
Aconitate hydratase, cytoplasmic	1351856	99/5.7				79	158/0.51	NO ID
Allene oxide cyclase 4 (AOC4)	15222241	28/9.2				75	2384/0.60	NO ID
Unnamed protein with CIMS domain	257676175	85/6.0				238	383/0.45	NQ
Aspartate aminotransferase Asp2	15239772	44/6.8	1.52	VGALSIVCK	0.72			NQ
Beta-ketoacyl-ACP synthetase 1	7385217	46/9.5				168	1140/0.47	NQ
Transcription (2)
RNA helicase	3775985	46/4.5				156	1140/0.47	1.12^NS
		47/4.5				143	1102/0.55
		47/4.2				119	1051/1.53
KH domain-containing protein NOVA	15237716	36/5.7				91	1509/1.95	NO ID
Protein synthesis (10)
40S ribosomal protein S3	9758155	27/4.6				154	1831/1.99	0.82^NS
60S ribosomal protein L12	6729494	18/9.0				128	2605/0.61	1.84^NS
^&Eukaryotic translation initiation factor-5A	40805177	17/5.7				210	2529/0.43	0.61^NS
		17/5.7				104	2605/0.61
Ribosomal protein S1	30692346	45/5.1				272	1259/0.50	1.44^NS
Elongation factor 1-alpha	295789	50/9.2				199	1103/1.92	0.48^S
Elongation factor Tu, chloroplastic	2494261	52/6.2				79	1193/1.81	1.06^NS
^&Eukaryotic initiation factor 4A	303844	47/5.3				155	1140/0.47	1.11^NS
Translation initiation factor 3 subunit g	9755847	33/8.3				142	1831/1.99	NO ID
Ribosomal protein L16	550544	21/9.9				118	2420/1.57	NO ID
Rab GTPase	15237059	52/5.8	5.00	HYAHVDCPGHADYVK	0.74	106	1158/1.91	NQ
				IVVELIVPVACEQGMR	1.33
Protein folding, transporting and degradation (13)
Multicatalytic endopeptidase beta subunit	15235889	25/5.3	2.07	ITQLTDNVYVCR	1.29			0.88^NS
Cyclophilin 38 (CYP38)	15232123	48/5.1				126	1573/1.66	1.35^NS
^&Aspartic protease	510880	28/8.3				48	1748/1.50	0.98^NS
^&Mitochondrial processing peptidase alpha subunit	15218090	47/4.5				302	1102/0.55	0.98^NS
		46/4.5				270	1140/0.47
		46/4.5				247	1150/0.64
Molecular chaperone Hsp90-2	38154485	80/5.0				145	389/0.44	1.28^NS
20S proteasome beta subunit; multicatalytic endopeptidase	2511578	30/6.7				179	2119/2.66	1.03^NS
20S proteasome subunit PAE1	3421087	26/4.7				61	2315/0.57	1.39^NS
Proteasome	166830	31/5.0				243	1944/1.87	1.04^NS
ClpC protease	4105131	99/8.8				97	273/0.59	1.12^NS
Cyclophilin (CYP20-3)	405131	28/8.8				116	2222/1.67	1.12^NS
Chaperonin 60 beta (CPN60B)	15222729	64/6.2				185	712/0.55	1.59^S
ATPDIL1-3 (PDI-LIKE 1-3)	22331799	78/4.7				135	333/0.62	0.93^NS
		78/4.8				130	335/0.63
Putative ATP-dependent Clp protease proteolytic subunit ClpP6	13194778	25/9.4				77	2352/0.57	NO ID
Signal transduction (3)
Phospholipase D alpha 1 (PLD1)	13124444	92/5.2				270	322/0.66	0.90^NS
		92/5.4				246	273/0.59
MAP kinase 12	30690210	52/6.2				131	1193/1.81	0.46^S
Predicted protein, containing calcium binding motif	159462486	97/4.6				67	153/0.60	NO ID
		97/5.6				61	218/0.47
Membrane and transport (3)
Potassium channel protein	1063415	37/8.2				62	1771/1.74	1.15^NS
P-Protein – like protein	14596025	114/6.5				69	158/0.51	0.95^NS
Unnamed protein, containing pfam00153 (mitochondrial carrier protein) domain	223638918	32/9.4				122	1767/1.50	NQ
Stress and defense (10)
Early-responsive to dehydration 8	15241115	78/4.8				586	336/0.62	1.52^NS
		78/4.8				489	335/0.63
		75/4.8				364	385/0.61
Glycine-rich RNA binding protein	17819	16/5.6				224	2715/0.46	1.05^NS
						200	2725/0.42
Unnamed protein product, containing cd03013 (peroxiredoxin family) domain	227247694	22/9.0				178	2559/0.62	1.03^S
Monodehydroascorbate reductase	14764532	47/5.8				410	1189/0.48	0.98^NS
^&Low expression of osmotically responsive genes 1 (LOS2)	15227987	48/5.5				344	1102/0.55	0.89^NS
^&Daikon cysteine protease RD21	219687002	32/4.6				218	1767/1.50	1.00^NS
		30/4.5				93	1856/1.70
Heat shock cognate protein HSC70	2655420	71/5.1				459	379/0.64	0.91^NS
Germin-like protein	1755154	25/6.8				79	2274/0.58	0.93^NS
Putative manganese superoxide dismutase	169244541	25/8.5				83	2384/0.60	1.95^S
^&Myrosinase	414103	62/6.3	18.20	QIIQDFKDYADLCFK	0.71			0.80^NS
				CSPMVDTKHRCYGGNSSTEPYIVAHNQLLAHATVVDLYR	1.22
Cell Structure (5)
^&Plastid-lipid associated protein PAP2	14248550	35/4.8				61	2199/1.79	1.40^NS
^&Extensin-like protein	15235668	82/6.5	2.00	IPASICQLPK	1.20			1.05^NS
^&Actin	9082317	42/5.3				547	1297/0.66	0.79^NS
^&TUB4 (tubulin beta-4 chain)	15241472	50/4.8				427	916/1.55	0.91^NS
Putative tubulin alpha-2/alpha-4 chain	34733239	50/4.9				250	897/1.56	NO ID
		50/5.2				172	799/1.57
Cell divison, differentiation and fate (1)
^&Proliferating cell nuclear antigen	408232	29/4.6				226	1856/1.70	2.86^S
		28/4.6				104	1908/1.81
Unknown (4)
CBS domain-containing protein	15238284	23/9.1				205	2559/0.62	1.23^NS
Hypothetical protein	15225545	49/7.6	2.02	MCCLFINDLDAGAGR	1.34			1.19^NS
Unknown protein	18396941	30/9.5	2.00	LGACVDLLGGLVK	0.64			0.73^NS
Hypothetical protein	147799132	82/8.8				55	345/0.60	NO ID

Overlapping proteins with ABA results shown in Table 1 are labeled with ‘&’. Protein names in bold are newly identified as potentially redox regulated, and those in italics showed redox changes but were not identified or quantified in the iTRAQ experiments. Mr, molecular mass; pI, isoelectric point; ‘Spot No./Fold Change’, DIGE spot number and fold change of spot volume; UC, unique spot in control gel; ‘iTRAQ ratio’: NS, non-signficant quantification; S, significant quantification; NO ID, no identification; NQ, no quantification