Table 2.

Positive Clones from the 293 Cell Line Assay Representing Previously Identified Proteins

No.	NCBI accession	Protein	Absorbance 486 nm	Localization	Putative signal
Cell surface or secreted proteins
1	806752	Na,K-ATPase alpha-1 subunit	0.12	cell surface, multiTM, prediction	MLLWIGAILCFLAYSIQA
2	7861733	low density liproprotein receptor related	0.12	cell surface, 1TM, prediction	n.d.
3	4151807	membrane-associated guanylate kinase-interacting protein 2	0.13	cell surface, prediction	n.d.
4	66344454	betaglycan, TGF-receptor type III	0.13	cell surface or secreted, prediction	MTSHYVIAIFALMSFCLA
5	699577	lumican (keratan sulfate proteoglycan	0.13	secreted, experimental	MSLSAFTLFLALIGGTSG
6	2529742	Rb-8 neural cell adhesion molecule	0.13	cell surface, 1TM, prediction	MSLLLSFYLLGLLVRSGQA
7	180948	carboxylesterase	0.13	secreted, experimental	MWLRAFILATLSASAAWA
8	5923891	cyclophilin-related protein	0.13	cell surface, 1 TM, experimental	n.d.
9	9664928	frizzled-3	0.13	cell surface, multiTM, prediction	MAMTWIVFSLWPLTVFMGHIGG
10	34618	MGP precursor (AA-19 to 84)	0.14	secreted, experimental	MKSLILLAILAALAVVTLC
11	6560599	small solute channel 1	0.14	cell surface, multiTM, experimental	n.d.
12	758063	gastric lipase precursor	0.14	secreted, experimental	MWLLLTMASLISVLGTTHG
13	179720	complement protein C8 beta subunit	0.15	secreted, prediction	MKNSRTWAWRAPVELFLLCAALGCLS
14	3329376	E25 protein	0.15	cell surface, 1TM, prediction	MLTLLGLSFILAGLIVGGAC
15	6165625	procollagen C-terminal proteinase	0.16	secreted, prediction	MRGANAWAPLCLLLAAATQLSRQQS
16	506404	cadherin-11	0.16	cell surface, 1TM, experimental	MKENYCLQAALVCLGMLCHSHA
17	2160714	carboxypeptidase Z precursor	0.16	secreted, experimental	MPPPPLLLLLTVLVVAAARP
18	2213913	neuronal calcium channel alpha 1A subunit	0.16	cell surface, multiTM, experimental	MKSIISLLFLLFLFIVVFALLG
19	182280	EVI2 protein	0.23	cell surface, 1TM, prediction	MEHTGHYLHLAFLMTTVFSLSPGTKA
20	4336325	small membrane protein 1	0.25	cell surface, multiTM, prediction	n.d.
21	3982775	insulin receptor binding protein GRB-IR	0.26	cell surface, mitochondrion and cytoplasm, experimental	n.d.
22	6707925	T calcium channel alpha1I subunit	0.29	cell surface, multiTM, experimental	n.d.
23	414928	G protein-coupled receptor	0.33	cell surface, multiTM, experimental	MTDKYRLHLSVADLLFVITLPFWAVDA
24	31442	integrin beta 1 subunit precursor	0.34	cell surface, 1TM, experimental	n.d.
25	1663517	membrane glycoprotein M6	0.34	cell surface, multiTM, prediction	MLAWLGVTAFTSLPVYMLA
26	11559216	MS4A6	0.34	cell surface, multiTM, prediction	MMVLSLGIILASASFSPNFTQVTS
27	6434904	tetraspanin TM4-C	0.35	cell surface, multiTM, prediction	MMILFNLLIFLCGAALLAVGIWV
28	6642960	glycoprotein-associated amino acid	0.39	cell surface, multiTM, experimental	MIHVKRCTPIPALLFTCISTLLMLVTS
29	386790	cell surface glycoprotein	0.39	cell surface, 1TM, experimental	MRMATPLLMQALPMGALP
30	5457049	protocadherin beta 7	0.46	cell surface, 1TM, prediction	MEARVERAVQKRQVLFLCVFLGMSWAGA
31	337360	receptor tyrosine kinase	0.46	cell surface, 1TM, prediction	MKPATGLWVWVSLLVAAGTVQP
32	516263	adenylyl cyclase	0.49	cell surface, multiTM, prediction	MLPLPLTWAILAGLGTSLLQVILQVVI
33	5042232	disintegrin-protease	0.54	cell surface, 1TM, prediction	MLRGISQLPAVATMSWVLLPVLWLIVQTQA
34	9965402	twisted gastrulation protein precursor	0.56	secreted, prediction	MKLHYVAVLTLAILMFLTWLPESLS
35	178250	angiogenin	0.57	secreted and nuclear, experimental	MVMGLGVWLLVFVLGLGLTPPTLA
36	5457045	protocadherin beta 5	0.57	cell surface, 1TM, prediction	METALAKTPQKRQVMFLAILLLLWEAGSEA
37	3006228	Zn-alpha2-glycoprotein	0.58	secreted, experimental	MVPVLLSLLLLLGPAVPQ
38	3127176	sulfonylurea receptor 2B	0.62	cell surface, multiTM, experimental	MNAAIPIAAVLATFVTHAYA
Intracellular proteins
39	303616	PIG-F	0.13	ER, multiTM, prediction	MHKRWVYSSLLISLSFMVFSWMA
40	37265	TRAM protein	0.14	ER membrane, multiTM, experimental	n.d.
41	6911590	calnexin	0.14	ER membrane, 1TM, experimental	MEGKWLLCML LVLGTAIVEA
42	307311	neuroendocrine-specific protein C	0.17	ER membrane, multiTM, experimental	n.d.
43	9502013	cholinephosphotransferase 1 beta	0.50	microsome and nuclear, multiTM, experimental	MAPNSITLLGLAVNVVTTLVLISYC
44	6329074	UDP-N-acetylglucosaminyltransferase	0.12	golgi, 1TM typell, prediction	MRLRNGTVATALAFITSFLTLS
45	496369	glucocerebrosidase	0.32	lysosomal, experimental	MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQ
46	4164448	NADH:ubiquinone oxidoreductase ASHI	0.14	mitochondrion, prediction	MQLFGFLAFMIFMCWVGDVYP
47	4689104	NADH-ubiquinone oxidoreductase ASHI	0.49	mitochondrion, prediction	MQLFGFLAFMIFMCWVGD
48	388166	Bax alpha	0.15	cytoplasmic, nuclear and mitochondrial, experimental	n.d.
49	603074	ATP:citrate lyase	0.13	cytoplasmic, experimental	n.d.
50	2443338	myosin phosphatase target subunit 1	0.14	cytoplasmic, experimental	n.d.
51	8671754	DAZ associated protein 1	0.15	cytoplasmic, prediction	n.d.
52	1236915	cyclin G2	0.17	cytoplasmic, prediction	n.d.
53	5442446	thioltransferase	0.19	cytoplasmic, prediction	n.d.
54	440306	natural-killer enhancer protein	0.20	nuclear and cytoplasmic, experimental	n.d.
55	2282030	Arp2	0.27	cytoplasmic, experimental	n.d.
56	13591593	RING finger protein with leucine	0.51	cytoplasmic, prediction	MKMSVILGIIHMLFGVSLS
57	7542723	DHHC1 protein	0.13	nuclear, cytoplasmic, prediction	n.d.
58	2924760	CIRP (cold-inducible RNA-binding protein)	0.12	nuclear, prediction	n.d.
59	510408	DNA primase (p58 subunit)	0.13	nuclear, prediction	n.d.
60	565643	hnRNP B1 protein	0.51	nuclear, experimental	n.d.
61	7239366	groucho-related protein 4	0.30	nuclear, experimental	n.d.
62	521144	ELAV-like neuronal protein 1	0.40	nuclear, experimental	n.d.
Localization unknown
63	5410355	insulin induced protein 2	0.17	unknown, multiTM	MIRGVVLFFIGVFLALVLNLLQIQR
64	9963859	PTD019	0.19	unknown, 1TM	MRAFRKNKTLGYGVPMLLLIVGGSFG
65	4929220	colon cancer-associated protein Mic1	0.44	unknown, 0TM	n.d.