Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Peptides of selected proteins identified by MS/MS spectrum. A: The MS/MS sequencing of the specific peptide of Nogo-B: KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR. B: The MS/MS sequencing of the specific peptide of B-RAF: SSSAPNVHINTIEPVNIDDLIR. Reversed database searching were performed to optimize the specificity of the data, and the results were shown under the sequence of each peptide.
