Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
The MS intensities of peptide GVDNTFADELVELSTALEHQEYITFLEDLK labeled H (m/z 1165.92) and labeled D (m/z 1168.60) in peak area and peak height.
| m/z | Peak area | Peak height | Ratio of area | Ratio of height |
|---|---|---|---|---|
| 1165.92 | 4084412 | 1240520 | 4.42 | 4.22 |
| 1168.60 | 18036323 | 5230797 |
