Table 2.
B cell clusters connecting the periphery and CSF.
| CSF IgG | SM IgG | PC IgG | DN IgG | CSF IgM | SM IgM | DN IgM | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Pat. | IGHV | H-CDR3 | IGHJ | # | SHM | # | SHM | # | SHM | # | SHM | # | SHM | # | SHM | # | SHM |
| 14711 | 1-18 | CARDSRGFADIW | 5 | 1124 | (13-16) | 48 | (14) | 50 | (14-16) | ||||||||
| 1-24 | CATGGISSSSDDWYNYFYGLDLW | 6 | 31 | (19-21) | 19 | (19) | |||||||||||
| 1-3 | CAGPVWAGSPNWKPWFGVDVW | 6 | 1766 | (8-19) | 34 | (16-18) | |||||||||||
| 1-8 | CARVVRYKITWYFDPW | 5 | 29 | (14-15) | 111 | (15) | |||||||||||
| 3-11 | CARDRFGVFDFW | 4 | 16 | (21) | 1 | (27) | |||||||||||
| 3-11 | CARDLRGRTRSIATVRGLLYDAFDIW | 3 | 9 | (14) | 33 | (16-18) | |||||||||||
| 3-23 | CAKDAGWYLYYYFDLW | 2 | 453 | (22-24) | 56 | (22) | |||||||||||
| 3-30/33rn | CARRPEGYAMDVW | 6 | 3 | (11) | 13 | (10) | |||||||||||
| 3-30/33rn | CAKDLVSDHYYYYGMDVW | 6 | 54 | (11-13) | 13 | (11) | |||||||||||
| 4-34 | CARGPKNKRFPMAPAEFFDYW | 4 | 15 | (21-22) | 7 | (27-28) | |||||||||||
| 4-34 | CARLGSWWLLTALRSTKGQYYYGMDVW | 6 | 210 | (11-24) | 35 | (22) | |||||||||||
| 4-4 | CARGGFSITWGGFDIW | 3 | 36 | (27-28) | 1 | (28) | |||||||||||
| 4-59/61 | CAKYDFWSGFDPW | 5 | 40 | (10) | 23 | (10) | |||||||||||
| 4-b | CARSYGDYVDPFFDYW | 4 | 64 | (18-34) | 689 | (6-19) | |||||||||||
| 6-1 | CARSGKPTGGGVLAWGPKKFVSSLYFDSW | 4 | 1146 | (26-32) | 8 | (26-29) | |||||||||||
| 30512 | 2-5 | CAHSKMATMGGELVFDYW | 4 | 68 | (3-4) | 7717 | (3-8) | ||||||||||
| 31012 | 1-24 | CATQSGMITASPLDYW | 4 | 1988 | (2-4) | 113 | (2-9) | ||||||||||
| 1-24 | CATGRKSGVVGAYFDYW | 4 | 35 | (0) | 48 | (1-2) | |||||||||||
| 3-21 | CATGGAAEHAYW | 4 | 116 | (36-37) | 19 | (36) | 2 | (30) | 11 | (27-32) | 6 | (29) | |||||
| 3-48 | CVRDRDIVTSDSW | 4 | 9 | (20) | 2 | (34) | |||||||||||
| 3-53/66 | CAKENIAALGNPLDFW | 4 | 68 | (17) | 1 | (18) | |||||||||||
| 3-9 | CVKDMEPYGDPLRPAEAFDFW | 3 | 279 | (23-25) | 4 | (26) | |||||||||||
| 4-34 | CVRGGPNTEYWPNFDSW | 4 | 1 | (26) | 33 | (23-25) | |||||||||||
| 34012 | 1-18 | CARTYFYGSENRQEYDWFDPW | 5 | 4892 | (15-22) | 1 | (16) | ||||||||||
| 3-21 | CARSTRTMHQGKSGMDVW | 6 | 45 | (23) | 4 | (24) | |||||||||||
| 3-21 | CARSTRSMHHRNSAMDVW | 6 | 83 | (23-26) | 2 | (25) | |||||||||||
| 3-30/33rn | CARNSFYCSSISCFYRPGSKRDYYHYGMDVW | 6 | 775 | (11-15) | 1 | (12) | |||||||||||
| 4-30-4/31 | CARGESSGSYVCFDCW | 4 | 498 | (17-21) | 6 | (19) | 13 | (19) | |||||||||
| 4-34 | CSRGALVATHVFDYW | 4 | 986 | (28-37) | 4 | (28-33) | |||||||||||
| 4-39 | CARRIILIGGAFDIW | 3 | 78 | (24) | 3 | (24) | |||||||||||
| 43113 | 3-7 | CARGTVFVVLLTSYFDYW | 4 | 4 | (29) | 1 | (28) | ||||||||||
| 3-7 | CARGRFFEFLLTSYFDYW | 4 | 30 | (29-30) | 32 | (28) | |||||||||||
| 4-39 | CARLQQWVEIW | 5 | 34 | (19-20) | 19 | (20-21) | |||||||||||
| 4-39 | CARGPVSLGTLDPW | 5 | 487 | (8-28) | 87 | (24-25) | |||||||||||
| 4-39 | CARRGRGWAPFDSW | 4 | 17 | (25) | 34 | (25) | |||||||||||
| 4-39 | CARGPVSRGDAPTPW | 5 | 4 | (23) | 1 | (24) | |||||||||||
| 4-39 | CATPLRDSSDYSTFDIW | 3 | 7 | (21) | 15 | (21-23) | |||||||||||
| 4-39 | CARHERDHTGFLNYYFDSW | 4 | 11 | (21) | 1 | (8) | |||||||||||
| 4-39 | CARRPQDFWSPYYTTYYFDSW | 4 | 360 | (7-25) | 1 | (7) | 32 | (18) | |||||||||
| 4-39 | CARLGASHYDSSGYYYYFDYW | 4 | 1 | (11) | 14 | (10) | |||||||||||
| 4-59/61 | CARATRFNMHWYPFVDLW | 2 | 56 | (20) | 8 | (18) | |||||||||||
| 4-b | CARPYFDGSGYYWDVLAFDVW | 3 | 10 | (7-8) | 9 | (7-9) | |||||||||||
| 6-1 | CARYTSGWFLDYW | 4 | 1 | (7) | 70 | (18-23) | |||||||||||
| 43213 | 4-59/61 | CAREYSRKEGGRWRVPKTGRYSYNSGMDVW | 6 | 6 | (29) | 16 | (35) | ||||||||||
| 6-1 | CARRTTLGFFDYW | 4 | 13 | (3) | 12 | (9) | |||||||||||
| 6-1 | CARYTSGWFLDSW | 5 | 2766 | (7-12) | 29 | (9-11) | 49 | ||||||||||
Clusters are grouped by patient; each row represents a bi-compartmental cluster. IGHV/IGHJ: closest related variable and joining germline segments utilized by Ig-VH sequences within each cluster. H-CDR3, representative H chain CDR3 aminoacid sequence per cluster, the N-terminal Cys (C) and C-terminal Trp (W) are shown for better visual orientation. Each B cell subset or CSF contributing to bi-compartmental clusters is represented in a column showing number of Ig-VH sequences (#) and range of SHM (SHM) along the IGHV sequence portion observed in CSF and PB B cell subsets (SM, switched memory B cells; PC, plasma cells/plasmablasts; DN, double negative B cells). Gray shades indicate clusters represented in Figure 2.