Figure 1. Example code illustrating the creation of a JavaScript array of sequence objects, the options and the call necessary to create the alignment viewer.

var MySeqs = Array();
MySeqs.push({ id :"id1b1.L", sequence :"SASSSVNYMYACREFGHIKLMNPTRSTVWY"}); 
MySeqs.push({ id :"id1a.L",  sequence :"SASSSTNYMYACDEFGHIKLMNPQRSTVWY"});
MySeqs.push({ id :"id2b1.L", sequence :"SASSTCNYMTACDEEGHIKLMNP-RSTCWY"}); 

var MyOptions = Array();
MyOptions.sortable = true;
MyOptions.selectable = true; 
MyOptions.deletable = true; 
MyOptions.toggleDotify = true;
MyOptions.toggleNocolour = true;
MyOptions.consensus = true;
MyOptions.selectColour = true;
			 
printJSAV(’sequenceDisplay’, MySeqs, MyOptions);