Table I. List of identified β-oxidation–related enzymes uniquely detected in the b′θ-1 phosphoproteome.
LC-MS/MS analysis of phosphoproteome differences between b′θ-1 and wild-type seedlings grown in Suc-free media. The phosphopeptides related to peroxisomal β-oxidation enzymes were found once in three replicates. The detected peptide and its q value are presented. The phosphorylated residue is shown in boldface for the type of amino acid (S, Ser; T, Thr; and Y, Tyr). AGI, Arabidopsis Genome Initiative; GDSL, glycine, aspartate, serine, and leucine around the active site serine.
| AGI | Annotation | Acronym | Detected Peptide | q Value |
|---|---|---|---|---|
| AT4G11030 | Long-chain acyl-CoA synthetase5 | LACS5 | GQSHVAASPFCDK | 0.025 |
| GVMISNESIVTITTGVMHFLGNVNASLSEK | 0.037 | |||
| AT1G04710 | Peroxisomal 3-ketoacyl-coa thiolase1 | KAT1 | INVNGGAIAIGHPLGATGAR | 0.049 |
| AT1G73610 | GDSL esterase/lipase | ACELFVNQGAAMFNQQLSADIDNLGATFPGAK | 0.03 | |
| AT3G14820 | GDSL-like lipase/acylhydrolase superfamily protein | LNNMALHFNSKLSSSLDTLK | 0.015 | |
| AT4G28570 | Long-chain fatty alcohol dehydrogenase family protein | LHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDTESGCK | 0.045 | |
| AT2G19450 | Diacylglycerol O-acyltransferase1 | DGAT | SLANAADKANPEVSYYVSLKSLAYFMVAPTLCYQPSYPR | 0.013 |
| AT1G31480 | Phosphatidic acid-preferring phospholipase A1 | NPDYVGKISIYGHSLGSVLSYDILCHQHNLSSPFPMDSVYK | 0.017 | |
| AT1G10670 | ATP-citrate lyase A-1 | MRALGDDIGVPIEVYGPEATMTGICK | 0.036 |