Table 1.
Amino acid sequences of hNaV1.7-active peptides discovered in this study
| Venom | Toxin name | Sequence | Observed mass (Da) | Calculated mass (Da) | Identity (%) |
|---|---|---|---|---|---|
| Haplopelma doriae | μ-TRTX-Hd1a | -ACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL | 3819.9 | 3819.7 | 100 |
| Chromatopelma cyaneopubescens | μ-TRTX-Ccy1a | DDCLGIFKSCNPDNDKCCES--YKCSRRDKWCKYVL | 4027.0 | 4027.8 | 62 |
| Chromatopelma cyaneopubescens | μ-TRTX-Ccy1b | DDCLGFFKSCNPDNDKCCEN--YKCNRRDKWCKYVL | 4115.6 | 4115.8 | 59 |
| Orphnaecus species 11 | μ-TRTX-Osp1a | -GCKGFGKACKYGADECCKN--LVCSKKHKWCKYTL | 3692.5 | 3692.8 | 60 |
| Orphnaecus species 21 | μ-TRTX-Osp1b | -ECLGWMKGCEPKNNKCC--SSYVCTYKYPWCRYDL | 3963.5 | 3963.7 | 56 |
| Euathlus pulcherrimaklaasi | μ-TRTX-Ep1a | -DCLKFGWKCNPRNDKCC--SGLKCGSNHNWCKLHL | 3800.8 | 3800.7 | 50 |
| Selenocosmia effera | μ-TRTX-Se1a | -DCLGWMAGCDFNDNKCC--AGYVCK-KHPWCRYDL | 3707.9 | 3707.5 | 38 |
Masses are monoisotopic masses, either determined experimentally using MALDI-TOF MS or calculated using PeptideMass (http://web.expasy.org/peptide_mass/). % identity was calculated relative to Hd1a.
1
Orphnaecus species 1 and 2 were collected from Sibaliw and Maanghit Caves, respectively, on Panai Islands in the Philippines. We have tentatively assumed that these are the same species, and the toxins have been named accordingly.