Figure 1.

Schematic diagram of minigenes used to encode the TM sequences. (A) Each box represents a section of the constructions made within the Invitrogen pSecTag A plasmid. (B) Oligonucleotide sequences used for cloning are indicated. (C) Amino acid sequence was as follows, using one-letter codes: signal sequence peptide (METDTLLLWVLLLWVPGSTG, 1-20), artificial extracellular sequence (extracellular tag, ET) from the multiple cloning site (DAAQPARRAVRSF, 21-33), different TM regions as indicated, including the stop transfer tribasic sequence (as indicated, 34-60; except for the EGF receptor sequence that is one amino acid longer), followed by the intracellular domain (HPAQWRPLESRGPEQKLISEEDLNSAVDHHHHHH, 61-94) containing the myc and 6His tags. Mutations introduced to decrease peptide dimerization are underlined in each sequence (see DISCUSSION), and the C-terminal tribasic stop sequence is italicized.