Table 1.
“Berlin patient” versus “Essen patient”. Differences between the “Berlin” and the “Essen” patient receiving a CCR5-delta32 homozygous allogeneic stem cell transplantation.
| Berlin patient | Essen patient | |
|---|---|---|
| Age, sex | 40 years, male | 27 years, male |
| Malignancy | acute myeloid leukemia | anaplastic large T-cell lymphoma |
| Time between infection and ART | 7 years | 3 years |
| Time between infection and Tx | 12 years | 5 years |
| Tx regimen | intermediate intensity | myeloablative + 12 Gy TBI |
| Immunosuppression | ATG, CSA, MTX, MMF | ATG, CSA, MTX, |
| GVHD | max. grade 1 (skin) | max. grade 1–2 (skin) |
| Engraftment | day +11 | day +39 |
| ART discontinuation | on day of Tx | 7 days before Tx |
| V3 sequence | CIRPNNNTRKGIHIGPGRAFYTTGEIIGDIRQAHC | CTRPNNNTRKGIPLGPGKVFYAT-EIIRDIRKAYC |
| >3 months prior Tx * | ||
| X4 prediction ** | ||
| 3months prior Tx | capable | intermediate |
| Immediate prior Tx | nd | capable |
* Discrepancy to the HIV type B V3 consensus sequence (CTRPNNNTRKSIHIGPGRFYTTGEIIGDIRQAHC) are marked in bold and underlined. ** Prediction of using the CXCR4 receptor (DNA or RNA according to Geno3Pheno). ART = antiretroviral therapy, ATG = anti-thymocytic globulin, CSA = cyclosporine A, MMF = mycophenolate mofetil, MTX = methotrexate, nd = not done, TBI = total body irradiation, Tx = transplantation.