Skip to main content
. 2015 Sep 10;5:161–170. doi: 10.1016/j.dib.2015.09.002

Fig. 11.

Fig. 11

ESI-MS spectra of the hGrx-2(41–164) tryptic peptide MESNTSSSLENLATAPVNQIQETISDNCVVIFSK obtained from a Grx-2/EdAG mixture (50 μM Grx-1+1 mM EdAG) incubated for 24 h at 37 °C in PBS, pH 7.4 and in presence of 250 μM TCEP. The observed molecular weight indicates that the peptide contains a carbamidomethyl derivative (CAM) of the cys residue as a result of reaction with iodoacetamide. The result was confirmed by high mass accuracy MS/MS data (not shown).