Skip to main content
. Author manuscript; available in PMC: 2015 Oct 29.
Published in final edited form as: Virology. 2013 Apr 29;442(2):122–131. doi: 10.1016/j.virol.2013.03.029

Fig. 3.

Fig. 3

ETD MS/MS spectrum recorded on [M+4H]+4 ions (m/z 939.46) corresponding to O-GlcNAc-modified PPV-CP peptide PVSQVSGPQLQTFGTYGNEDASPSNSNALVNTNR. To acquire this spectrum, an ETD-enabled LTQ mass spectrometer was operated in the data dependent mode. Singly and doubly charged fragment ions that were observed and labeled in the spectrum indicate that the O-GlcNAc moieties are located on S65 of PPV.