Table 2.
Details of the pGADT7-rec clones containing CDS encoding peptides fused to the GAL4 AD, identified through Y2H screening with the bait 1R-MYB protein.
“Bait” clone in pGBKT7 | pGADT7-rec clonea | GenBank accession number | Length of peptide (amino acids) | Peptide sequenceb | Protein sequence ID | Peptide identityc |
---|---|---|---|---|---|---|
MYB TF (TUS38128) (complete sequence, 337 amino acids) | 1 | XM_012713836 | 52 | GKFGVYSSQHPLQCAVDGIDTDFNYDSETGLTTFSIPVPQEGMYRWSIEIQI | XP_012569290 | GSGT2 |
GenBank accession: XM_004508882 Protein sequence accession: XP_004508939.1 | 4 | XM_004498761 | 88 | EIVSKIESAAKSLRFKVGKVKEFKLKLQGMMEGRKGKLAVTAEIYEVAPELAVVEFSKCSGDTFEYVKFFEDDVRPALKDIVWSWQGE | XP_004498818 | CIPK25 |
5 | NM_001309718 | 46 | SIVKISVKYHTKGDLVLSDAVRDETKAKGTGLLKAIEGYVLANPDY | NP_001296647 | ABR17-like |
Prey clone isolated from the pGADT7-Rec library.
Peptide sequence identified (based on BLASTX analysis). The nucleotide sequence encoding the peptides fused to the GAL 4 AD, was confirmed to be in the correct reading frame.
Annotation of sequence is based on both BLASTN and BLASTX analysis.