Table 2.

Vectors and constructs used in this study.

plasmid	description	reference
pSET152	Streptomyces/E. coli shuttle vector. Integrates in Streptomyces	[36]
pWHM3	Streptomyces/E. coli shuttle vector	[37]
pΔcslZ	pWHM3 derivative containing the flanking regions of the S. lividans cslZ gene (SLI_3189) interspersed by the apra-loxP cassette	this work
pΔdtpA	pWHM3 derivative containing the flanking regions of the S. lividans dtpA gene (SLI_4211) interspersed by the apra-loxP cassette	this work
pΔSLI_4212	pWHM3 derivative containing the flanking regions of the S. lividans SLI_4212 gene interspersed by the apra-loxP cassette	this work
pTDW46	pSET152 derivative containing the dagA gene, where the sequence corresponding to the original DagA signal peptide is replaced by aadA, the streptomycin resistance gene	[25]
pTDW47	pTDW46 containing a fragment encoding the DagA signal peptide	[25]
pMLCP1	pSET152 derivative with dtpA under control of the sco promoter	this work
pMLCP2	pTDW46 derivative containing a fragment encoding the putative DtpA signal sequence (MPDQSIPQTRSPEATRGTPGPLDSDNPGAATAPEGVSRRRLLGTAGATGLVLGAAGAAAGYAAAPSSAATPLTSLGSGS)	this work
pMLCP3	pTDW46 derivative containing a fragment encoding the CslZ signal sequence (MYGSKPAGNMSRRRAASAAALGAAALLLAGCSSSGDGDDKAAGAGITQQPKETDGS)	this work
pMLCP4	pTDW46 derivative containing a fragment encoding the putative ECuC signal sequence (MRRLAEGPVRRLAGGPVRRRPALAAVAVIGALTLAGCGGSDSGADSASPGAELSVDAAGS)	this work
pMLCP5	pTDW46 derivative containing a fragment encoding the putative GlxA signal sequence (MKDRAGRRRARRFAIGTAVVVALAGMNGPWLGS)	this work
pET4211	pET28a vector with N-terminal His-tag, containing the dtpA (SLI_4211) gene restricted between the NdeI and HindIII sites	this work
pET3188	pET28a vector with N-terminal His-tag, containing the glxA (SLI_3188) gene encoding residues 35-645, restricted between the NdeI and HindIII sites	[14]