Skip to main content
. 2016 Feb 19;72(Pt 3):214–219. doi: 10.1107/S2053230X16002272

Table 1. Macromolecule-production information.

Source organism S. pseudintermedius (strain IV369-1041)
DNA source Clinical sample obtained from Quotient Bioresearch Ltd (GenBank code CP002478)
Expression vector pET-15
Expression host E. coli strain BL21(DE3)
Complete amino-acid sequence MGSDKIHHHHHHENLYFQSEKETKAFNLKTAKGEEKIDIPKDPKRIVVMAPTYAGGLKYLDANIVGVSDQVDQSPVLAKQFKDVDKVGAEDVEKVASLKPDLIITYNTDKNTDKLKKIAPTIAFDYAKYNYLEQQEAMGDIVGKSDEVKKWKADWEKQTAQDSKDIKAHLGDDTSVTIFEDFDKKIYAYGKNWGRGSEVLYQAFGLQMPKALDDATKKEGWTEVPKEEVGKYAGDVIITAKAKDAAQPEFQKTAMWQNLEAVQNKYAFNVDSSVYWYNDPYTLDVIRKDLKKQLLALPTN

Complete sequence of the recombinant FhuD protein construct produced. Underlined residues are the hexahistidine tag and the TEV cleavage site derived from cloning procedures and were removed by TEV protease prior to crystallization screening and other experiments.