Skip to main content
. 2016 Mar 23;6:23600. doi: 10.1038/srep23600

Table 1. N-terminal sequence of different protein bands.

Segregated Proteins N-terminal Sequence Homologous Proteins
Band 1 PGREQQEENVPYLFKSQRSQSRSRASHMDF Allergenic vicilin from Solanum lycopersicum
Band 2 YKEYPGQHGQQGQTGI-P/I-LTXQARHQR/V Hypothetical protein sorbidraft, Vitis vinifera
Band 3 GLEENIQTTKIRTNMEEYYYADIYVI Hypothetical protein Vitis vinifera, Arabidopsis lyrata
Band 4 GLEETIRSAKLRENNDNPPAAADVYNPQGG 11S globulin storage Sesamum indicum
Band 5 GIEETYTMKLRENIGHPXXXDDVNNPRGR 11S globulin storage Sesamum indicum