Skip to main content
. 2016 Apr 5;7:427. doi: 10.3389/fmicb.2016.00427

Figure 6.

Figure 6

Downstream gene model modification —A0QWY3. Illustrates the downstream modification of an annotated predicted gene model A0QWY3 by 16 amino acids, with the identification of a TSS peptide MHAIEVAETGGPEVLNYIERPEPSPGPGEVLIK with a non-tryptic N-terminal downstream of the annotated TSS. In this case, the downstream TSS peptide corresponded to the N-terminal of the GeneMarkS predicted sequence for this ORF, thus allowing this semi-tryptic TSS peptide to be included in the GeneMarkS database search space. The modified sequence is identical to I7G8G0, predicted for the same strain but not included in the Reference proteome. Panel (A) visualizes the identified peptides using the Ensembl genome browser, with the downstream TSS peptide highlighted in red. The downstream gene model modification of A0QWY3 corresponds with the simultaneous upstream gene model modification of A0QWY4 on the opposite strand, supporting both reannotations. Panel (B) illustrates the modified gene model, with the TSS peptide highlighted in red. Panel (C) illustrates a representative MS/MS spectrum for the downstream TSS peptide, which was identified from 34 MS/MS scans using the GeneMarkS database search.