Table 2.

Summary of information and bioinformatics analyses of the 10 selected peptides

Level	Gene ID	Product description	Annotated GO component term	Location aa position	Code	Peptide aa sequence	Length	Maximum probability of B-cell epitope by Bepipred
6	PF3D7_1112000	Conserved Plasmodium protein, unknown function	Integral to membrane, plasma membrane	54–72	PF6-111	KFNYDPFYSNWEKKNIQDS	19	0.52
6	PF3D7_0601900	Conserved Plasmodium protein, unknown function	Maurer’s cleft	76–98	PF6-060	MSKHYEDDDDDDDYQPPRHSSLP	23	0.68
4	PF3D7_1313500	Conserved Plasmodium membrane protein, unknown function	extracellular region, membrane	740–769	PF4-131	KSHHKNIHNNNTVEYNSEEDGNSKSKLSKD	30	0.7
4	PF3D7_1233400	Conserved Plasmodium membrane protein, unknown function	Cell surface, extracellular region	489–513	PF4-123	RKKIYTHKTTRKKHKDNPDYEKALL	25	0.71
4	PF3D7_1437500	Conserved Plasmodium membrane protein, unknown function	Integral to membrane, plasma membrane	7–36	PF4-143	VKIDNGESDEYNSTNQSPRKLNDSSGLSKK	30	0.75
4	PF3D7_1138200	Conserved Plasmodium protein, unknown function	Integral to membrane, plasma membrane	7–23	PF4-113	ICGRPLRNGGTAPLIYN	17	0.58
2	PF3D7_0209600	Transporter, putative	Integral to membrane	6–27	PF2-020	RSSVTRTSNEESNEDDKNCVNV	22	0.561
2	PF3D7_1471200	Inorganic anion exchanger, inorganic anion antiporter (SulP)	Integral to plasma membrane, membrane	65–84	PF2-147	IKWGWGFTNTPKETSKYYIN	20	0.72
2	PF3D7_1250200	Conserved Plasmodium membrane protein, unknown function	Apicoplast, integral to membrane, membrane	445–474	PF2-125	DKDDNKEDDNNDDDNNDNHHNNDDNNDDHH	30	0.65
2	PF3D7_1125000	Conserved Plasmodium protein, unknown function	Apicoplast, plasma membrane	129–148	PF2-112	FNVEEMGTGKTDDIHTPIEV	20	0.6

Level is with respect to Fig. 2. aa amino acid, Code peptide fragment name