Table 2.
Details of overexpressed and newly appearing proteins identified by mass spectrometry from M. tuberculosis laboratory strain S7 under hypoxia compared to aerated cultures.
| Spot no | Rv no | Protein Name | Predicted M.Wt (kDa) | Predicted pI | Coverage (%) | Peptide matched |
|---|---|---|---|---|---|---|
| S7D1 | Rv0440 | GroEl2 | 65 | 4.8 | 11% | GLNALADAVK, EIELEDPYEK |
| S7D2 | Rv3667 | Acetyl coA synthetase | 80 | 5.9 | 10% | LLITSDGQFRR, RGHPAPLKDAADEAVSQPDSPVEHVLVVRRTGIDVSWNDER, AEVAEAISPIARPR |
| S7D3 | Rv0405 | Polyketide synthase-6 (pks6) | 110 | 5.4 | 1% | TASALAAQAGRLGR |
| S7D4 | Rv2220 | Glutamine synthetase | 62 | 5.3 | 16.70% | SVFDDGLAFDGSSIR, GGYFPVAPNDQYVDLR, MLTNINSGFILEK, LVPGYEAPINLVYSQR |
| S7D5 | Rv1679 | Possible acyl-CoA dehydrogenase FadE16 | 55 | 4.9 | 23% | VDTDCAFPAEAVDALRK, ASVNDAALTITESAMR |
| S7D6 | Rv2953 | Trans-acting enoyl reductase | 42 | 6.1 | 20% | MMLGPNAADWPLILADASQPLTLEAMAAR, STAVLLAQSGLALALDRDR |
| S7D7 | Rv3029c | Probable electron transfer flavo protein beta subunit | 31 | 4.8 | 4.90% | EAADAVLDEINER |
| S7D8 | Rv3060c | GntR family transcriptional regulator | 33 | 5.2 | 2.30% | TYGASGMPSR |
| S7D9 | Rv0632c | Probable enoyl-CoA hydratase EchA3 | 25 | 5.8 | 13.80% | VFSGGFDLK, GGFELAYR, ILTSGEVQPAIDMLR |
| S7D10 | gi| 183985444 | Integral membrane protein | 21 | 4.7 | 0.90% | GPIPFDAPRER |
| S7D11 | gi| 518086696 | Cyclase [M. tuberculosis] | 20 | 4.8 | 11.10% | AIADIEAYPQWISEYK |
| S7D12 | Rv3716c | Conserved protein | 15 | 4.4 | 19% | VVDPDDIETLQDLIVGAMR |
| S7D13 & 14 | Rv2031c | Heat shock protein (HspX) | 16 | 4.6 | 29% | ATTLPVQRHPR, AELPGVDPDKDVDIMVR, SEFAYGSFVR |
| S7D15 | Rv3418c | 10 kDa chaperonin (GROES) | 12 | 4.2 | 58% | IPLDVAEGDTVIYSK, RIPLDVAEGDTVIYSK |
| S7D16 | Rv2445c | Probable nucleoside diphosphate kinase K (NDK) | 15 | 5.3 | 22.80% | GLTIAALQLR |
| S7D17 | Rv3875 | ESAT-6 | 12 | 4.3 | 17.90% | WDATATELNNALQNLAR |
Details of proteins characterization by mass spectrometry from the S7anaerobic cultures (designated as S7D). Bold underlined spot numbers indicate the newly appearing proteins during hypoxia. For few spots gene number was not described in protein search tool, in such case accession number was given.