Skip to main content
. 2016 Nov 14;14:17. doi: 10.1186/s12953-016-0106-9

Table 3.

Peptides set as biomarkers differentially detected between fertilized group and non-fertilized group

m/z RT Charge Highest mean condition max fold change Protein Accession number Peptide sequence
Exp.1 Exp.2
401.22 ± 0.00 28.2 ± 0.11 2* non-fertilized 8.94b 3.07c ALBU_Human P02768 AASQAALGL
402.23 ± 0.00 25.3 ± 0.66 1 non-fertilized 2.16b 2.44c
409.18 ± 0.00 24.8 ± 0.22 1 non-fertilized 2.7a 1.99b
410.17 ± 0.00 36.4 ± 0.26 1 fertilized 3.09a 11.07b
412.34 ± 0.00 44.3 ± 0.02 1* non-fertilized 3.36b 2.78b
414.34 ± 0.01 43.3 ± 2.37 1* non-fertilized 1.93c 2.00c
416.37 ± 0.00 46.0 ± 0.15 1* non-fertilized 2.11c 14.22a
424.29 ± 0.01 46.5 ± 0.15 1* fertilized 4.18b 2.24a
426.32 ± 0.02 48.0 ± 0.77 1 fertilized 1.49c 2.33b
438.36 ± 0.02 52.4 ± 1.14 1 non-fertilized 2.67c 2.76a
439.28 ± 0.00 25.0 ± 0.38 1* non-fertilized 2.88b 215.28b
442.94 ± 0.00 27.2 ± 0.60 3 non-fertilized 21.09b 2.57a
459.72 ± 0.00 22.1 ± 0.30 2* non-fertilized 27.37b 12.84b
475.01 ± 0.00 23.4 ± 0.48 4* non-fertilized 5.63b 1.77b
477.28 ± 0.00 47.6 ± 0.48 1* non-fertilized 25.53a 25.84c
478.62 ± 0.00 41.8 ± 0.00 3* non-fertilized 3.02b 1.18c
480.80 ± 0.00 40.5 ± 0.82 2* fertilized 1.22c 1.30c
490.24 ± 0.02 46.5 ± 0.25 1 fertilized 1.70b 8.68c
494.29 ± 0.02 46.4 ± 0.97 1* non-fertilized 549.84a 2.59b IGBP-5_Human P24593 FVGGAENTAHPRII
496.97 ± 0.00 43.1 ± 0.39 3 fertilized 1.36b 1.40b
500.24 ± 0.00 26.7 ± 0.26 3 non-fertilized 341.3c 2.55c
526.41 ± 0.02 52.1 ± 1.08 1 non-fertilized 3.59b 3.10a
528.28 ± 0.00 34.1 ± 0.11 2* fertilized 3.61b 1.94c CO3_Huamn P01024 IHWESASLL
530.29 ± 0.00 45.8 ± 1.13 1* fertilized 1.87c 6.26c
539.66 ± 0.00 44.7 ± 0.41 6 non-fertilized 2.08b 1.73b
545.33 ± 0.00 44.8 ± 0.26 6 non-fertilized Infinita 2.08b
546.99 ± 0.00 44.7 ± 0.42 6 non-fertilized 1.93b 1.60b
552.30 ± 0.00 28.7 ± 0.11 5 non-fertilized 68.46c 2.24b
552.67 ± 0.00 44.7 ± 0.40 6 non-fertilized 3.05c 1.60c
554.33 ± 0.00 44.7 ± 0.41 6 non-fertilized 2.00c 1.70b
558.40 ± 0.00 51.1 ± 0.31 2 non-fertilized 1795.51a Infinita
570.43 ± 0.02 51.9 ± 1.06 1 non-fertilized 4.31b 3.77c
574.68 ± 0.00 44.8 ± 0.40 6 non-fertilized 4.33b 2.39c
576.35 ± 0.00 44.8 ± 0.41 6 non-fertilized 2.24b 1.94b
577.28 ± 0.00 33.5 ± 0.77 1* non-fertilized 1.42b 2.26b
579.18 ± 0.00 44.8 ± 0.39 6 non-fertilized 2.19b 1.95c
588.43 ± 0.01 45.5 ± 1.66 1 non-fertilized 43.29b 4.46c
594.30 ± 0.00 24.0 ± 0.14 2* fertilized 3.09b 2.90a ITIH1_human P19827 LPDRVTGVDTD
602.42 ± 0.00 51.4 ± 1.02 2 non-fertilized 164.28c Infinita
609.72 ± 0.00 30.0 ± 0.00 5 non-fertilized 10.0b 1.91a
643.33 ± 0.00 29.0 ± 1.59 2* non-fertilized Infinitc 2.59a A2AP_human P08697 MEPLGRQLTSGP
658.49 ± 0.02 51.7 ± 0.99 1 non-fertilized 7.59b 11.57b
702.51 ± 0.02 51.6 ± 1.01 1 non-fertilized 6.36b 12.66c
703.75 ± 0.00 31.1 ± 1.97 5 non-fertilized Infinita 1.79b
727.59 ± 0.00 28.0 ± 0.07 4* non-fertilized 1266.81a 2.03b
740.96 ± 0.00 30.6 ± 0.05 5 non-fertilized 4.35b 1.91a PLST_HUMAN P13797 DGETLEELMKLSPEELLLRWANFHLENSGWQ
755.34 ± 0 12.2 ± 0.36 2 non-fertilized 2.04b 2.16a
761.97 ± 0.00 31.0 ± 0.01 5 non-fertilized 6.85b 2.10a
805.39 ± 0.00 35.8 ± 0.01 1* non-fertilized Infinitc 7.38b
859.44 ± 0.00 29.4 ± 0.04 4 non-fertilized Infinita 2.94a
869.68 ± 0.00 32.7 ± 0.15 4 non-fertilized Infinitb 3.92c
924.74 ± 0.00 38.0 ± 0.41 3* non-fertilized Infinitc 9.77b
953.51 ± 0.00 29.1 ± 0.23 3 non-fertilized 12.72b 3.24c DIAP1_HUMAN O60610 AEPHFLSILQHLLLVRNDYEARPQ

a p < 0.01; b p < 0.05; c p < 0.1

*:significant difference in validation experiment