Skip to main content
. 2016 Sep 8;7(1):10.1128/ecosalplus.ESP-0006-2016. doi: 10.1128/ecosalplus.esp-0006-2016

Table 8.

Structural characteristics of toxins produced by ETEC

Toxin # aa M Sequence/arrangementa Structure
STa graphic file with name esp-0006-2016_ig_001.jpg
 Subtype STaH 19 2,000 N S S N Y C C E L C C N P A C T G C Y
 Subtype STaP 18 2,000 N T F Y C C E L C C N P A C A G C Y
EAST1 38 4,100 Not determined
 17-2 strain MPSTQYIRRPASSYASCIWCTTACASCHGRTTKPSLAT
 0-42 strain MPSTQYIRRPASSYASCIWCATACASCHGRTTKPSLAT
STb 48 5,200 STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC graphic file with name esp-0006-2016_ig_002.jpg
LTI 85,000 AB5 graphic file with name esp-0006-2016_ig_003.jpg
 B-subunit 103 11,600
 A-subunit 240 28,000
a

Letters in bold and italics indicate the region involved in binding to the receptor. Underlined letters indicate the change observed for EAST1 variants.

HHS Vulnerability Disclosure