TABLE 1.
Antibodies used in this study
| Antibody | Host | Antigen | Source | Catalog# | Dilution | References |
|---|---|---|---|---|---|---|
| SAP102 | Ms | Fusion protein of rat SAP102 (aa1-120) | UC Davis/NIH Neuromab, Davis, CA |
75-058 RRID: AB_2261666 |
1:500 | Haverkamp et al., 2000 |
| PSD95 | Rb | Synthetic peptide of mouse PSD95 (aa50-150) | Abcam, Cambridge, MA |
ab18258 RRID: AB_444362 |
1:1000 | Preissmann et al., 2012 |
| PSD95 | Ms | Fusion protein of human PSD95 (aa77-299) | UC Davis/NIH Neuromab, Davis, CA |
75-028 RRID: AB_2292909 |
1:500 | Puthussery et al., 2014 |
| SAP97 | Ms | Fusion protein of rat SAP97 (aa1-104) | UC Davis/NIH Neuromab, Davis, CA |
75-030 RRID: AB_2091920 |
1:500 | Koulen et al., 1999 |
| Chapsyn 110 | Ms | Fusion protein of rat Chapsyn 110 (aa1-852) | UC Davis/NIH Neuromab, Davis, CA |
75-057 RRID: AB_2277296 |
1:500 | Ogawa et al., 2008 |
| Ribeye U2656 | Rb | B domain of rat ribeye | Dr. Thomas Südhof, Stanford U. School of Medicine, CA |
N/A RRID: AB_2315280 |
1:1000 | Schmitz et al., 2000 |
| Syntaxin 3 | Rb | Residues 2–264 of mouse syntaxin 3B fused to Glutathione S-transferase |
Dr. Roger Janz, U. of Texas Medical School, Houston, TX |
N/A RRID: AB_2315430 |
1:500 | Sherry et al., 2006 |
| mGluR6 | Rb | C-terminus of human mGluR6 (aa 401–419) coupled to Keyhole Limpet hemocyanin (KATSTVAAPPKGEDAEAHK) |
Dr. Noga Vardi, U. Pennsylvania, Philadelphia, PA |
N/A RRID: AB_2314792 |
1:500 | Vardi et al., 2000 |
| GluR6/7 | Rb | Rat GluR6 (aa894-908) coupled to KLH (HTFNDRRLPGKETMA) |
Millipore, Temecula, CA |
04–921 RRID: AB_1587072 |
1:200 | Darstein et al., 2003 |
| GluR5 | Gt | C-terminus peptide of human GluR-5 (aa 900- 918) (MQFNNNYIFSIFIILH) |
Santa Cruz Biotechnology, Dallas, TX |
sc-7616 RRID: AB_641048 |
1:500 | Pan et al., 2007 |
| Kir2.1 | Rb | Peptide from human Kir2.1 (aa392-410) (NGVPESTSTDTPPDIDLHN) | Millipore, Temecula, CA |
AB5374 RRID: AB_91818 |
1:400 | Giovannardi et al., 2002 |
| Pannexin 2 | Rb | Synthetic peptide derived from C-terminus of mouse Pannexin 2 (SDMGDLLSIPPPQQILIATFEEPRTVVSTVEF) |
ThermoFisher, Waltham, MA |
42–2800 RRID: AB_2533518 |
1:200 | |
| Cx57 | Rb | Synthetic peptide derived from mouse Cx57 (aa 434–446) (SRLMSEKGQRHSD) |
Invitrogen, Camarillo, CA |
40–4800 RRID: AB_2314266 |
1:100 | Ciolofan et al., 2007 |
| Cx59 | Rb | Synthetic peptide derived from C-terminus of human Cx59 (aa486-501) (EPGLVRPCNNPVCPPN) |
Dr. Stephen Massey, U. of Texas Medical School, Houston, TX |
N/A | 1:100 |