Skip to main content
. Author manuscript; available in PMC: 2017 Sep 16.
Published in final edited form as: ACS Chem Biol. 2016 Jul 11;11(9):2438–2446. doi: 10.1021/acschembio.6b00397

Figure 1. Schematic illustration of lanthipeptide biosynthesis using cytolysin S as an example.

Figure 1

The leader peptide is shown schematically whereas the amino acid sequence is shown for the core peptide Amino acid residues involved in post-translational modifications are highlighted in color. Sequence of the leader peptide of CylLS = MLNKENQENYSNKLELVGPSFEELSLEEMEAIQGSGDVQAE.