. 2017 Jan 3;18(1):60. doi: 10.3390/ijms18010060

Table 1.

Some selected examples of the differentially phosphorylated (DP) proteins identified under abscisic acid (ABA) treatment.

Sequence	Protein Group	Annotation	Abbreviation	Modifications	Average CK	Average 3 h	Average 12 h
VLPAQQSSPR	LOC_Os01g09620	Zinc finger/CCCH transcription factor	OsDOS	S8 (Phospho)	0	0	4.09 × 10⁸
GGGGSAGLGSMNVEEILR	LOC_Os01g64730	bZIP transcription factor	OsABF1	S5 (Phospho); S10 (Phospho)	0	5.15 × 10⁷	4.27 × 10⁷
LQSPGAQQTYGTSQQVDASAGNQGMLSPYR	LOC_Os01g68860	Zinc finger C-x8-C-x5-C-x3-H type family protein	C3H12	S3 (Phospho)	7.78 × 10⁷	0	0
STVGTPAYIAPEVLSR	LOC_Os02g34600	CAMK_CAMK_like.13	SAPK6	T2 (Phospho)	0	3.31 × 10⁷	0
AGLQQQQQQQPGTPGR	LOC_Os02g54600	STE_MEK_ste7_MAP2K.5—STE kinases	SMG1	T13 (Phospho)	5.30 × 10⁸	2.31 × 10⁸	3.50 × 10⁸
VQAHQGSASFR	LOC_Os03g16570	Zinc finger, C3HC4 type domain containing protein	OsSDIR1	S9 (Phospho)	3.39 × 10⁷	4.57 × 10⁷	0
HNDWIVDSTYNLR	LOC_Os04g38480	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor	OsSERK2	S8 (Phospho)	6.81 × 10⁷	0	0
AMELSGPR	LOC_Os04g38480	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor	OsSERK2	S5 (Phospho)	6.81 × 10⁷	0	0
EVLSSEPEEIGNDEK	LOC_Os04g55230	Tetratricopeptide repeat domain containing protein	FLO-2	S5 (Phospho)	3.82 × 10⁷	0	0
YVISPDNQEIGEK	LOC_Os05g26890	G-protein alpha subunit	D1/RGA1	S4 (Phospho)	1.82 × 10⁷	8.12 × 10⁶	1.21 × 10⁷
DNLQGSAFLGSSR	LOC_Os07g06130	Ethylene-insensitive protein	MHZ7	S12 (Phospho)	0	2.52 × 10⁷	7.02 × 10⁷
HPFFAVSAPASPTR	LOC_Os07g39220	BES1/BZR1 homolog protein	OsBZR1	S7 (Phospho); S11 (Phospho)	6.49 × 10⁷	0	0
ADSPNPSSGDHPAGVGGSPEK	LOC_Os07g39480	OsWRKY78	OsWRKY78	S18 (Phospho)	3.04 × 10⁷	0	0
DFGSMNMDELLR	LOC_Os09g28310	bZIP transcription factor	bZIP72	S4 (Phospho)	0	0	1.48 × 10⁷
QGSLTLPR	LOC_Os09g28310	bZIP transcription factor	bZIP72	S3 (Phospho)	6.65 × 10⁷	1.83 × 10⁸	3.15 × 10⁸
STVGTPAYIAPEVLLK	LOC_Os12g39630	CAMK_CAMK_like.49	SAPK9	T2 (Phospho)	0	6.51 × 10⁷	9.71 × 10⁷