Skip to main content
. 2015 Mar 6;5:8819. doi: 10.1038/srep08819

Table 1. Proteins identified by MALDI-TOF-MS in gel bands of PtpA D126A substrate trapping assays.

Band Namea Protein name Protein accession Mass (Da) Mascot scoreb No. of matched  sequencesb No. of peptide  sequencesb Sequence coverageb (%) Peptide sequences confirmed by MS/MS
a Heat shock protein HSP-90 beta HS90_HUMANf 83242 134 8 7 13 IDIIPNPQERGVVDSEDLPLNISR
b Trifunctional enzyme subunit alpha, mitochondrial ECHA_HUMAN 82947 127 21 16 28 TLQEVTQLSQEAQRTVLGTPEVLLGALPGAGGTQR
  6-phosphofructokinase, platelet type K6PP_HUMAN 85542 118 24 19 31 YLEEIATQMRAIGVLTSGGDAQGMNAAVR
c ATP synthase subunit alpha, mitochondrial ATPA_HUMAN 59714 128 10 9 26 EAYPGDVFYLHSRTGAIVDVPVGEELLGREVAAFAQFGSDLDAATQQLLSR
  Tubulin beta-5 chainc TBB5_HUMANf 49640 261 26 21 61 FPGQLNADLRAILVDLEPGTMDSVRISEQFTAMFR
  Tubulin alpha-1C chaind TBA1C_HUMANf 49863 163 18 16 47 AVFVDLEPTVIDEVR
d Sulfide quinone oxidoreductase, mitochondrial SQRD_HUMAN 49929 188 22 19 49 IMYLSEAYFRIMYLSEAYFR+Oxid(M)YADALQEIIQER GYWGGPAFLR
e Actin, cytoplasmice ACTB_HUMANf 41710 82 4 4 15 SYELPDGQVITIGNER
f Phosphate carrier protein, mitochondrial MPCP_HUMAN 39933 76 7 6 18 IQTQPGYANTLR
g Cytochome C1, mitochondrial CY1_HUMAN 35399 77 3 2 9 AANNGALPPDLSYIVR+Deamidated NQ
h Heat Shock protein beta 1 HSPB1_HUMAN 22768 167 5 5 29 LFDQAFGLPRLATQSNEITIPVTFESR

aBand name corresponds to the gel pieces indicated in the SDS-PAGE shown in Fig. 3.

bFor each protein the value of score, number of matched and peptide sequences indicated is the best value obtained from two biological replicates.

cTBB3_HUMAN, TBB2A_HUMAN and TBB4B_HUMAN were also identified with the same set of peptides.

dTBA1A_HUMAN, TBA1B_HUMAN were also identified with the same set of peptides.

eACTG_HUMAN was also identified with the same set of peptides.

fProteins identified in mock substrate trapping using the more sensitive approach of Nano LC-MS.