Table II. The top ten phosphorylated peptides that increase the most in intensity and are statistically significant in FGF1 treated chondrocytes as compared to the untreated samples.
| Log2 (Ctrl/treated) | -Log10 p value | q-value | Peptide Sequence | UniProt acc # | Gene name | Protein names | |
|---|---|---|---|---|---|---|---|
| 2 hours | |||||||
| 1 | −4.02 | 1.57 | 0.040 | EPLLSSSENGTGGTEAAPADAR | Q9Z1I6.1 | Arhgef1 | Rho guanine nucleotide exchange factor 1 |
| 2 | −3.80 | 1.31 | 0.049 | LDNTPASPPRSPAEPSDIPIAK | D4A858 | Tacc2 | Transforming, Acidic Coiled-Coil Containing Protein 2 |
| 3 | −3.65 | 1.49 | 0.042 | ENGSDTLPSSPGSGDQTLPDHAPF | Q6PCT3 | Tpd52l2 | Tumor protein D54 |
| 4 | −3.42 | 2.09 | 0.021 | SADNSLENPFSK | F1LMP9 | Dab2 | Disabled homolog 2 |
| 5 | −3.29 | 1.64 | 0.040 | LLSSNEDDASILSSPTDR | Q4V8B3 | Med24 | Mediator of RNA polymerase II transcription subunit 24 |
| 6 | −3.27 | 2.69 | 0.018 | QKSAEPSPTVMSSSLGSNLSELDR | Q1EG89 | Pxn | Paxillin |
| 7 | −3.26 | 3.98 | 0.000* | ALAEEASEDEIPSDVDLNDPYFAEEVKK | Q76MT4 | Esf1 | ESF1 homolog |
| 8 | −3.24 | 1.65 | 0.041 | LTGQESGLGDSPPFEKESEPESPMDVDNSK | G3V8M8 | Parg | Poly(ADP-ribose) glycohydrolase |
| 9 | −3.23 | 2.77 | 0.011 | SSSTSSSTVTSSAGSEQQNQSSSGSESTDK | F1M771 | Rybp | Death Effector Domain-Associated Factor |
| 10 | −3.23 | 1.63 | 0.040 | IGSDPLAYEPK | P26431 | Slc9a1 | Sodium/hydrogen exchanger1 |
| 8 hours | |||||||
| 1 | −4.32 | 3.10 | 0.019 | GESIEPLDPSEK | G3V6N1 | Erbb3 | Receptor tyrosine-protein kinase erbB-3 |
| 2 | −4.13 | 3.54 | 0.000* | TLGLSSPCDNR | Q64346 | Dusp6 | Dual specificity protein phosphatase 6 |
| 3 | −3.43 | 3.53 | 0.000* | LSQVNGSTPVSPVEPESK | O35821 | Mybbp1a | Myb-binding protein 1A |
| 4 | −3.39 | 3.56 | 0.000* | ALAEEASEDEIPSDVDLNDPYFAEEVKK | Q76MT4 | Esf1 | ESF1 homolog |
| 5 | −3.07 | 3.65 | 0.000* | GDSLAYGLR | P08721 | Spp1 | Osteopontin |
| 6 | −2.95 | 3.88 | 0.000* | SWESSSPVDRPELEAASPTTR | B2RYM6 | Zc3hc1 | Zinc Finger, C3HC-Type Containing 1(NIPA) |
| 7 | −2.94 | 4.26 | 0.000* | GSPTGSSPNNASELSLASLTEK | Q4KLM7 | Specc1 | Sperm Antigen With Calponin Homology And Coiled-Coil Domains 1 |
| 8 | −2.73 | 2.97 | 0.047 | EAIEMHENNGSTK | F1M9I4 | Heg1 | Heart Development Protein With EGF-Like Domains 1 |
| 9 | −2.48 | 3.26 | 0.015 | KVMDSDEDDDY | D4ADF5 | Pdcd5 | Programmed Cell Death 5 |
| 10 | −2.43 | 2.91 | 0.048 | KTSASPPLEKSGDEGSEDEAASGED | Q9EPJ0 | Nucks1 | Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 |
*q-value is less than 0.0009.