Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Kinetic parameters for pCDK2/cyclin A and pCDK2/cyclin E1
| Enzyme | Substrate | kcat (s−1) | Km (μM) | kcat/Km (s−1 μM−1) |
|---|---|---|---|---|
| pCDK2/cyclin A | HHASPRK | 34.2±2.5 | 793±89 | 0.046 |
| pCDK2/cyclin E1 (full length) | HHASPRK | 30.5±5.6 | 766±102 | 0.039 |
| pCDK2/cyclin E1 (81–363) | HHASPRK | 53.2±4.5 | 1005±127 | 0.053 |
| pCDK2/cyclin A | CDC6-modified peptidea | 18.9±2.4 | 74±24 | 0.25 |
| pCDK2/cyclin E1 (81–363) |
CDC6-modified peptidea |
22.6±1.7 |
181±31 |
0.125 |
| Sequence: HHASPRKQGKKENGPPHSHTLKGRRLVFDN (for further details, see text). | ||||
