TABLE 3.
MALDI-TOF MS/MS mass fragmentation data of a trypsin-digested peptide from the α-subunit of MCR from M. formicicus
| Peptide sequencea | Mol mass [M+H]+ (Da) |
||
|---|---|---|---|
| Calculated (a) | Measured (b) | b − a | |
| 422SNAGLNGWYLSQILHK437 | 1,800.939 | 1,816.932 | 15.993 |
| 423NAGLNGWYLSQILHK437 | 1,713.907 | 1,729.886 | 15.979 |
| 424AGLNGWYLSQILHK437 | 1,599.864 | 1,615.866 | 16.002 |
| 425GLNGWYLSQILHK437 | 1,528.827 | 1,544.825 | 15.998 |
| 426LNGWYLSQILHK437 | 1,471.806 | 1,487.792 | 15.986 |
| 427NGWYLSQILHK437 | 1,358.722 | 1,374.719 | 15.997 |
| 428GWYLSQILHK437 | 1,244.679 | 1,260.675 | 15.996 |
| 429WYLSQILHK437 | 1,187.657 | 1,203.651 | 15.994 |
| 430YLSQILHK437 | 1,001.578 | 1,001.579 | 0.001 |
| 431LSQILHK437 | 838.515 | 838.514 | −0.001 |
a
The sequence of the α-subunit peptide is 403AAVAAAASGISVCMATGNSNAGLNGWYLSQILHK437. The presence of hydroxyl-tryptophan Trp429 (in bold) was not included for the calculation of the mass. The MS/MS spectrum is shown in Fig. S2.