Figure - PMC

Skip to main content

An official website of the United States government

Here's how you know

Here's how you know

Official websites use .gov
A .gov website belongs to an official government organization in the United States.

Secure .gov websites use HTTPS
A lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.

View full-text article in PMC

. 2017 Aug 21;7:8363. doi: 10.1038/s41598-017-08743-y

Search in PMC
Search in PubMed
View in NLM Catalog
Add to search

© The Author(s) 2017

Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.

PMC Copyright notice

Stimulation of inflammatory responses by LipL32WT and its variants. (A) LipL32WT and its variants were used to stimulate the expression of IL-8 (white bar), TNF-α (light gray bar), MCP-1 (gray bar), MMP7 (dark gray bar), and GRO-α (black bar) on HEK293-TLR2 cell. LOMP, Leptospira outer membrane protein extraction; WT, wild-type LipL32 protein; ΔNβ1β2, deletion of β1β2 domains of LipL32; ΔCenα3, deletion of central α3 domain of LipL32; ΔCα4, deletion of C-terminal α4 domain of LipL32. (B) The synthesized peptides were used to stimulate the expression of IL-8 (white bar), TNF-α (light gray bar), MCP-1 (gray bar), MMP7 (dark gray bar), and GRO-α (black bar) on HEK293-TLR2 cell. N20 peptide (1–20 residues of LipL32); N50 peptide (1–50 residues of LipL32); C25 peptide (248–272 residues of LipL32), and a scrambling peptide with the sequence of VSLEGLTKVLAGSKFSESPILIKTVCDMILGASFANPALKISTASTLFTG. *p < 0.05; **p < 0.01.