Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
High resolution mass spectrometry enabled identification of highly and moderately charged neuropeptides with high confidence. A, The MS/MS spectra of a 5+ charged peptide ions detected at m/z 679.569 identified as YIQQVRKAPSGRMSVLKNLQGLDPSHRISD from the neuropeptide precursor cholecystokinin. B, MS/MS identification of a moderately-charged 3+ ion at m/z 1055.197 characterized as GWTLNSAGYLLGPHAIDNHRSFSDKHGLTamide (galanin).
