Figure 2.

Example of the output of a Blast query. Users can supply the amino acid sequence of a protein of interest and check if that protein or a homologous protein is in the MoonProt Database. In this example, the user submitted a fragment of the sequence for glycyl-tRNA synthetase, ‘FNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNV’. The search returns a sorted list of protein names ranked by their similarity to glycyl-tRNA synthetase, the query sequence. Clicking on the link for each protein name leads to its protein page.