Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
A) One novel diagnostic peptide “MCTKDSPFSMDYDLSQLQQPDTVEPDAIKPVGIR” represents a new exon splicing event with frame shift. B) A new exon splicing event inferred from novel diagnostic peptide “RWEGEDEDEDVKLEEPEESK” is cross supported by transcript evidence from EST library and homolog alignment to nr database.
